KEGG   Homo sapiens (human): 8653Help
Entry
8653              CDS       T01001                                 

Gene name
DDX3Y, DBY
Definition
DEAD (Asp-Glu-Ala-Asp) box helicase 3, Y-linked (EC:3.6.4.13)
Orthology
K17642  
ATP-dependent RNA helicase DDX3Y [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     8653 (DDX3Y)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     8653 (DDX3Y)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    8653 (DDX3Y)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Yq11
AA seq 660 aa AA seqDB search
MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGW
SCSKDKDAYSSFGSRDSRGKPGYFSERGSGSRGRFDDRGRSDYDGIGNRERPGFGRFERS
GHSRWCDKSVEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENF
SDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQI
YTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYG
GADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIR
RIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWV
EDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREE
ALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLAT
SFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDY
RQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgtggtggtgaaaaatgaccctgaactggaccagcagcttgctaatctggac
ctgaactctgaaaaacagagtggaggagcaagtacagcgagcaaagggcgctatatacct
cctcacttaaggaacagagaagcatctaaaggattccatgataaagacagttcaggttgg
agttgcagcaaagataaggatgcatatagcagttttgggtctcgagattctagaggaaag
cctggttatttcagtgaacgtggaagtggatcaaggggaagatttgatgatcgtggacgg
agtgactatgatggtattggcaatcgtgaaagacctggctttggcagatttgaacggagt
ggacatagtcgttggtgtgacaagtcagttgaagatgattggtcaaaaccacttccacca
agtgaacgcttggagcaagaactgttttctggaggaaacacggggattaactttgagaaa
tatgatgatataccagtagaggcaaccggcagtaactgtcctccacatattgagaatttt
agcgatattgacatgggagaaattatcatggggaacattgaacttactcgctatactcgt
cctactccagtgcaaaaacatgccattcctattattaagggaaaaagagacttaatggct
tgtgcccaaacaggatctgggaaaactgcagcatttcttttacccatactgagtcagata
tatacagatggtccaggagaagctttgaaggctgtgaaggaaaatggaaggtatgggcgc
cgcaaacaatatccaatatccttggttttagccccaacaagagaattggctgtacagatc
tatgaggaagccagaaaattttcctaccgatctagagttcgtccttgtgtagtttatggt
ggtgctgatattggtcagcagattcgggacttagaacgtggatgccacttgttagtagcc
actccaggacgtctagtggatatgatggaaagaggaaagattggattagacttctgcaag
tacttagtgttggatgaagctgataggatgctggatatgggatttgaacctcagatacgt
cgtatagttgaacaagatactatgccaccaaagggcgttcgtcacaccatgatgtttagt
gctacttttcctaaggaaatacagatgcttgctcgtgactttttggatgaatatatcttt
ttggctgtaggcagagtaggctctacctctgagaacatcacacagaaagtagtttgggtg
gaagacttagataaacggtcatttctactggacattttaggtgcaacagggagtgattca
cttactttagtgtttgtggagaccaaaaagggagcagattccctggaggatttcttatac
catgaaggatatgcttgtactagtattcatggagaccggtcacagagagatcgagaggag
gcccttcaccagtttcgctcaggaaaaagcccaattctagtggctacagctgtggcagca
cgaggactagacatttcaaatgtgagacatgttatcaattttgatttgccaagtgatatt
gaagaatatgtgcatcgtattggccgtacaggacgtgtaggaaacctgggccttgccacc
tcattctttaatgaaaaaaatatgaatattacaaaggatttgttggatcttcttgtagaa
gctaaacaagaagtgccttcttggttggaaaatatggcttatgaacaccactacaagggt
ggcagtcgtggacgatctaaaagtaatagattcagtggaggatttggtgccagagactat
cgacaaagtagtggttccagcagttctggctttggtgctagtcgcggaagcagcagccgc
agtggtggaggtggttacggcaacagcagaggatttggtggaggtggctatggaggcttc
tacaatagtgatggatatggaggaaattataactcccagggggttgactggtggggcaac
tga

DBGET integrated database retrieval system