KEGG   Homo sapiens (human): 8654Help
Entry
8654              CDS       T01001                                 

Gene name
PDE5A, CGB-PDE, CN5A, PDE5
Definition
phosphodiesterase 5A, cGMP-specific (EC:3.1.4.35)
Orthology
K13762  
cGMP-specific 3',5'-cyclic phosphodiesterase [EC:3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Drug target
Dipyridamole: 
Sildenafil: 
Tadalafil: 
Vardenafil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    8654 (PDE5A)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    8654 (PDE5A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     8654 (PDE5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q27
AA seq 875 aa AA seqDB search
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAE
RVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEG
TVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPL
NIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIIS
FMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTME
PLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGK
VKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETREL
QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGV
NNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAI
LATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAE
LVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCF
PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggccggccccagcttcgggcagcagcgacagcagcagcagccccagcagcag
aagcagcagcagagggatcaggactcggtcgaagcatggctggacgatcactgggacttt
accttctcatactttgttagaaaagccaccagagaaatggtcaatgcatggtttgctgag
agagttcacaccatccctgtgtgcaaggaaggtatcagaggccacaccgaatcttgctct
tgtcccttgcagcagagtcctcgtgcagataacagtgcccctggaacaccaaccaggaaa
atctctgcctctgaatttgaccggcctcttagacccattgttgtcaaggattctgaggga
actgtgagcttcctctctgactcagaaaagaaggaacagatgcctctaacccctccaagg
tttgatcatgatgaaggggaccagtgctcaagactcttggaattagtgaaggatatttct
agtcatttggatgtcacagccttatgtcacaaaattttcttgcatatccatggactgata
tctgctgaccgctattccctgttccttgtctgtgaagacagctccaatgacaagtttctt
atcagccgcctctttgatgttgctgaaggttcaacactggaagaagtttcaaataactgt
atccgcttagaatggaacaaaggcattgtgggacatgtggcagcgcttggtgagcccttg
aacatcaaagatgcatatgaggatcctcggttcaatgcagaagttgaccaaattacaggc
tacaagacacaaagcattctttgtatgccaattaagaatcatagggaagaggttgttggt
gtagcccaggccatcaacaagaaatcaggaaacggtgggacatttactgaaaaagatgaa
aaggactttgctgcttatttggcattttgtggtattgttcttcataatgctcagctctat
gagacttcactgctggagaacaagagaaatcaggtgctgcttgaccttgctagtttaatt
tttgaagaacaacaatcattagaagtaattttgaagaaaatagctgccactattatctct
ttcatgcaagtgcagaaatgcaccattttcatagtggatgaagattgctccgattctttt
tctagtgtgtttcacatggagtgtgaggaattagaaaaatcatctgatacattaacaagg
gaacatgatgcaaacaaaatcaattacatgtatgctcagtatgtcaaaaatactatggaa
ccacttaatatcccagatgtcagtaaggataaaagatttccctggacaactgaaaataca
ggaaatgtaaaccagcagtgcattagaagtttgctttgtacacctataaaaaatggaaag
aagaataaagttataggggtttgccaacttgttaataagatggaggagaatactggcaag
gttaagcctttcaaccgaaatgacgaacagtttctggaagcttttgtcatcttttgtggc
ttggggatccagaacacgcagatgtatgaagcagtggagagagccatggccaagcaaatg
gtcacattggaggttctgtcgtatcatgcttcagcagcagaggaagaaacaagagagcta
cagtcgttagcggctgctgtggtgccatctgcccagacccttaaaattactgactttagc
ttcagtgactttgagctgtctgatctggaaacagcactgtgtacaattcggatgtttact
gacctcaaccttgtgcagaacttccagatgaaacatgaggttctttgcagatggatttta
agtgttaagaagaattatcggaagaatgttgcctatcataattggagacatgcctttaat
acagctcagtgcatgtttgctgctctaaaagcaggcaaaattcagaacaagctgactgac
ctggagatacttgcattgctgattgctgcactaagccacgatttggatcaccgtggtgtg
aataactcttacatacagcgaagtgaacatccacttgcccagctttactgccattcaatc
atggaacaccatcattttgaccagtgcctgatgattcttaatagtccaggcaatcagatt
ctcagtggcctctccattgaagaatataagaccacgttgaaaataatcaagcaagctatt
ttagctacagacctagcactgtacattaagaggcgaggagaattttttgaacttataaga
aaaaatcaattcaatttggaagatcctcatcaaaaggagttgtttttggcaatgctgatg
acagcttgtgatctttctgcaattacaaaaccctggcctattcaacaacggatagcagaa
cttgtagcaactgaattttttgatcaaggagacagagagagaaaagaactcaacatagaa
cccactgatctaatgaacagggagaagaaaaacaaaatcccaagtatgcaagttgggttc
atagatgccatctgcttgcaactgtatgaggccctgacccacgtgtcagaggactgtttc
cctttgctagatggctgcagaaagaacaggcagaaatggcaggcccttgcagaacagcag
gagaagatgctgattaatggggaaagcggccaggccaagcggaactga

DBGET integrated database retrieval system