KEGG   Homo sapiens (human): 8654Help
Entry
8654              CDS       T01001                                 

Gene name
PDE5A, CGB-PDE, CN5A, PDE5
Definition
(RefSeq) phosphodiesterase 5A
  KO
K13762  cGMP-specific 3',5'-cyclic phosphodiesterase [EC:3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04022  cGMP-PKG signaling pathway
Drug target
Avanafil: D03217
Caffeine (DG00974): D00528 D01453 D07603
Dasantafil: D03657
Dipyridamole: D00302
Gisadenafil (DG01258): D09621 D09622
Sildenafil (DG00484): D02229 D08514
Tadalafil: D02008
Udenafil: D10027
Vardenafil (DG00487): D02731 D03260 D08668 D09989
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    8654 (PDE5A)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    8654 (PDE5A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     8654 (PDE5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 HD
Motif
Other DBs
NCBI-GeneID: 8654
NCBI-ProteinID: NP_001074
OMIM: 603310
HGNC: 8784
Ensembl: ENSG00000138735
Vega: OTTHUMG00000132971
Pharos: O76074(Tclin)
UniProt: O76074
Structure
PDB: 

Jmol
Position
4q26
AA seq 875 aa AA seqDB search
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAE
RVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEG
TVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPL
NIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIIS
FMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTME
PLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGK
VKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETREL
QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGV
NNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAI
LATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAE
LVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCF
PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggccggccccagcttcgggcagcagcgacagcagcagcagccccagcagcag
aagcagcagcagagggatcaggactcggtcgaagcatggctggacgatcactgggacttt
accttctcatactttgttagaaaagccaccagagaaatggtcaatgcatggtttgctgag
agagttcacaccatccctgtgtgcaaggaaggtatcagaggccacaccgaatcttgctct
tgtcccttgcagcagagtcctcgtgcagataacagtgcccctggaacaccaaccaggaaa
atctctgcctctgaatttgaccggcctcttagacccattgttgtcaaggattctgaggga
actgtgagcttcctctctgactcagaaaagaaggaacagatgcctctaacccctccaagg
tttgatcatgatgaaggggaccagtgctcaagactcttggaattagtgaaggatatttct
agtcatttggatgtcacagccttatgtcacaaaattttcttgcatatccatggactgata
tctgctgaccgctattccctgttccttgtctgtgaagacagctccaatgacaagtttctt
atcagccgcctctttgatgttgctgaaggttcaacactggaagaagtttcaaataactgt
atccgcttagaatggaacaaaggcattgtgggacatgtggcagcgcttggtgagcccttg
aacatcaaagatgcatatgaggatcctcggttcaatgcagaagttgaccaaattacaggc
tacaagacacaaagcattctttgtatgccaattaagaatcatagggaagaggttgttggt
gtagcccaggccatcaacaagaaatcaggaaacggtgggacatttactgaaaaagatgaa
aaggactttgctgcttatttggcattttgtggtattgttcttcataatgctcagctctat
gagacttcactgctggagaacaagagaaatcaggtgctgcttgaccttgctagtttaatt
tttgaagaacaacaatcattagaagtaattttgaagaaaatagctgccactattatctct
ttcatgcaagtgcagaaatgcaccattttcatagtggatgaagattgctccgattctttt
tctagtgtgtttcacatggagtgtgaggaattagaaaaatcatctgatacattaacaagg
gaacatgatgcaaacaaaatcaattacatgtatgctcagtatgtcaaaaatactatggaa
ccacttaatatcccagatgtcagtaaggataaaagatttccctggacaactgaaaataca
ggaaatgtaaaccagcagtgcattagaagtttgctttgtacacctataaaaaatggaaag
aagaataaagttataggggtttgccaacttgttaataagatggaggagaatactggcaag
gttaagcctttcaaccgaaatgacgaacagtttctggaagcttttgtcatcttttgtggc
ttggggatccagaacacgcagatgtatgaagcagtggagagagccatggccaagcaaatg
gtcacattggaggttctgtcgtatcatgcttcagcagcagaggaagaaacaagagagcta
cagtcgttagcggctgctgtggtgccatctgcccagacccttaaaattactgactttagc
ttcagtgactttgagctgtctgatctggaaacagcactgtgtacaattcggatgtttact
gacctcaaccttgtgcagaacttccagatgaaacatgaggttctttgcagatggatttta
agtgttaagaagaattatcggaagaatgttgcctatcataattggagacatgcctttaat
acagctcagtgcatgtttgctgctctaaaagcaggcaaaattcagaacaagctgactgac
ctggagatacttgcattgctgattgctgcactaagccacgatttggatcaccgtggtgtg
aataactcttacatacagcgaagtgaacatccacttgcccagctttactgccattcaatc
atggaacaccatcattttgaccagtgcctgatgattcttaatagtccaggcaatcagatt
ctcagtggcctctccattgaagaatataagaccacgttgaaaataatcaagcaagctatt
ttagctacagacctagcactgtacattaagaggcgaggagaattttttgaacttataaga
aaaaatcaattcaatttggaagatcctcatcaaaaggagttgtttttggcaatgctgatg
acagcttgtgatctttctgcaattacaaaaccctggcctattcaacaacggatagcagaa
cttgtagcaactgaattttttgatcaaggagacagagagagaaaagaactcaacatagaa
cccactgatctaatgaacagggagaagaaaaacaaaatcccaagtatgcaagttgggttc
atagatgccatctgcttgcaactgtatgaggccctgacccacgtgtcagaggactgtttc
cctttgctagatggctgcagaaagaacaggcagaaatggcaggcccttgcagaacagcag
gagaagatgctgattaatggggaaagcggccaggccaagcggaactga

DBGET integrated database retrieval system