KEGG   Homo sapiens (human): 8655Help
Entry
8655              CDS       T01001                                 

Gene name
DYNLL1, DLC1, DLC8, DNCL1, DNCLC1, LC8, LC8a, PIN, hdlc1
Definition
dynein, light chain, LC8-type 1
Orthology
K10418  
dynein light chain LC8-type
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    8655 (DYNLL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.23
AA seq 89 aa AA seqDB search
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaccgaaaggccgtgatcaaaaatgcggacatgtcggaagagatgcaacaggac
tcggtggagtgcgctactcaggcgctggagaaatacaacatagagaaggacattgcggct
catatcaagaaggaatttgacaagaagtacaatcccacctggcattgcatcgtggggagg
aacttcggtagttatgtgacacatgaaaccaaacacttcatctacttctacctgggccaa
gtggccattcttctgttcaaatctggttaa

DBGET integrated database retrieval system