KEGG   Homo sapiens (human): 8660Help
Entry
8660              CDS       T01001                                 

Gene name
IRS2, IRS-2
Definition
insulin receptor substrate 2
Orthology
K07187  
insulin receptor substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    8660 (IRS2)
   04022 cGMP - PKG signaling pathway
    8660 (IRS2)
   04152 AMPK signaling pathway
    8660 (IRS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    8660 (IRS2)
   04920 Adipocytokine signaling pathway
    8660 (IRS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    8660 (IRS2)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    8660 (IRS2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    8660 (IRS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q34
AA seq 1338 aa AA seqDB search
MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
ASIDFLSHHLKEATIVKE
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccgccgcggcacgggccgcccgggccggcgagcggagacggccccaacctc
aacaacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaagcag
aagcatggccacaagcgcttcttcgtgctgcgcggacccggcgcgggcggcgacgaggcg
acggcgggcggggggtcggcgccgcaaccgccgcggctcgagtactacgagagcgagaaa
aagtggcggagcaaggcaggcgcgccgaaacgggtgatcgctctcgactgctgcctgaac
atcaacaagcgcgccgacgccaagcacaagtacctgatcgccctctacaccaaggacgag
tacttcgccgtggccgccgagaacgagcaggagcaggagggctggtaccgcgcgctcacc
gacctggtcagcgagggccgcgcggccgccggagacgcgccccccgccgccgcgcccgcc
gcgtcctgcagcgcctccctgcccggcgccctgggcggctctgccggcgccgccggggcc
gaggacagctacgggctggtggctcccgccacggccgcctaccgtgaggtgtggcaggtg
aacctgaagcccaagggtctgggccagagcaagaacctgacgggggtgtaccgtctgtgc
ctgtctgcgcgcaccatcggcttcgtgaagctcaactgcgagcagccgtcggtgacgctg
cagctcatgaacatccgccgctgcggccactcggacagcttcttcttcatcgaggtgggc
cgctcggccgtcacaggccccggcgagctgtggatgcaggcggacgactcggtggtggcg
cagaacatccacgagaccatcctggaggccatgaaggcgctcaaggagctcttcgagttc
cggccgcgcagtaagagccaatcgtcggggtcgtcggccacgcaccccatcagcgtcccc
ggcgcgcgccgccaccaccacctggtcaacctgccccccagccagacgggcctggtgcgc
cgctcgcgcaccgacagcctggccgccaccccgccggcggccaagtgcagctcgtgccgg
gtgcgcaccgccagcgagggcgacggcggcgcggcggcgggagcggcggccgcgggcgcc
aggccggtgtcggtggctgggagccccctgagccccgggccggtgcgcgcgcccctgagc
cgctcgcacaccctgagcggcggctgcggcggccgcgggagcaaggtggcgctgctgccg
gcagggggcgcgctgcaacacagccgctccatgtccatgcccgtggcgcactcgccgccc
gccgccaccagccccggctccctgtcgtccagcagcggccacggctcgggctcctacccg
ccgccgcccggcccgcacccgcctctgccgcatccgctgcaccacggccccggccagcgg
ccctccagcggcagcgcctccgcctcgggctcccccagcgaccccggcttcatgtccctg
gacgagtacggctccagcccaggcgacctgcgcgccttctgcagccaccgaagcaacacg
cccgagtccatcgcggagacgcccccggcccgagacggcggcggcggcggtgagttctac
gggtacatgaccatggacaggcccctgagccactgtggccgctcctaccgccgggtctcg
ggggacgcggcccaggacctggaccgagggctgcgcaagaggacctactccctgaccacg
ccagcccggcagcggccggtgccccagccctcctctgcctcgctggatgaatacaccctg
atgcgggccaccttctcgggcagcgcgggccgcctctgcccgtcctgccccgcgtcctct
cccaaggtggcctaccacccctacccagaggactacggagacatcgagatcggctcccac
aggagctccagcagcaacctgggggcagacgacggctacatgcccatgacgcccggcgcg
gccctcgcgggcagtgggagcggcagctgcaggagcgacgactacatgcccatgagcccc
gccagcgtgtccgcccccaagcagatcttgcagcccagggccgccgccgccgccgccgcc
gccgtgccttctgcggggcctgcggggccagcacccacctctgcggcgggcaggacattc
ccggcgagcgggggcggctacaaggccagctcgcccgccgagagctcccccgaggacagt
gggtacatgcgcatgtggtgcggttccaagctgtccatggagcatgcagatggcaagctg
ctgcccaacggggactacctcaacgtgtcccccagcgacgcggtcaccacgggcaccccg
cccgacttcttctccgcagccctgcaccccggcggggagccgctcaggggcgttcccggc
tgctgctacagctccttgccccgctcctacaaggccccctacacctgtggcggggacagc
gaccagtacgtgctcatgagctcccccgtggggcgcatcctggaggaggagcgtctggag
cctcaggccacgccagggcccagccaggcggccagcgccttcggggccggccccacgcag
ccccctcaccctgtagtgccttcgcccgtgcggcctagcggcggccgcccggagggcttc
ttgggccagcgcggccgggcggtgaggcccacgcgcctgtccctggaggggctgcccagc
ctgcccagcatgcacgagtacccactgccaccggagcccaagagccccggcgagtacatc
aacatcgactttggcgagcccggggcccgcctgtcgccgcccgcgcctcccctgctggcg
tcggcggcctcgtcctcctcgctcttgtccgccagcagcccggcctcgtcgctgggctca
ggcaccccgggcaccagcagcgacagccggcagcggtctccgctctccgactacatgaac
ctcgacttcagctcccccaagtctcctaagccgggcgccccgagcggccaccccgtgggc
tccttggacggcctcctgtcccccgaggcctcctccccgtatccgccgttgcccccgcgt
ccgtccgcgtccccgtcgtcgtctctgcagccgccgccaccgccgccggccccgggggag
ctgtaccgcctgccccccgcctcggccgttgccaccgcccagggcccgggcgccgcctca
tcgttgtcctcggacaccggggacaatggtgactacaccgagatggcttttggtgtggcc
gccaccccgccgcaacctatcgcggcccccccgaagccagaagctgcccgcgtggccagc
ccgacgtcgggcgtgaagaggctgagcctcatggagcaggtgtcgggagtcgaggccttc
ctgcaggccagccagcccccggacccccaccgcggcgccaaggtcatccgcgcagacccg
caggggggccgccgccgccacagttccgagaccttctcctccaccacgacggtcaccccc
gtgtccccgtccttcgcccacaaccccaagcgccacaactcggcctccgtggaaaatgtc
tctctcaggaaaagcagcgagggcggcgtgggtgtcggccctggagggggcgacgagccg
cccacctccccacgacagttgcagccggcgccccctttggcaccgcagggccggccgtgg
accccgggtcagcccgggggcttggtcggttgtcctgggagcggtggatcgcccatgcgc
agagagacctctgccggcttccagaatggtctcaactacatcgccatcgacgtgagggag
gagcccgggctgccaccccagccgcagccgccgccgccgccgcttcctcagccgggagac
aagagctcctggggccggacccgaagcctcgggggtctcatcagcgctgtgggcgtcggc
agcaccggcggcgggtgcggggggccgggtcccggtgccctgccccctgccaacacctac
gccagcattgacttcttgtcccaccacttgaaggaggccaccatcgtgaaagagtga

DBGET integrated database retrieval system