KEGG   Homo sapiens (human): 8660Help
Entry
8660              CDS       T01001                                 

Gene name
IRS2, IRS-2
Definition
insulin receptor substrate 2
Orthology
K07187  
insulin receptor substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q34
AA seq 1338 aa AA seqDB search
MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
ASIDFLSHHLKEATIVKE
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccgccgcggcacgggccgcccgggccggcgagcggagacggccccaacctc
aacaacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaagcag
aagcatggccacaagcgcttcttcgtgctgcgcggacccggcgcgggcggcgacgaggcg
acggcgggcggggggtcggcgccgcaaccgccgcggctcgagtactacgagagcgagaaa
aagtggcggagcaaggcaggcgcgccgaaacgggtgatcgctctcgactgctgcctgaac
atcaacaagcgcgccgacgccaagcacaagtacctgatcgccctctacaccaaggacgag
tacttcgccgtggccgccgagaacgagcaggagcaggagggctggtaccgcgcgctcacc
gacctggtcagcgagggccgcgcggccgccggagacgcgccccccgccgccgcgcccgcc
gcgtcctgcagcgcctccctgcccggcgccctgggcggctctgccggcgccgccggggcc
gaggacagctacgggctggtggctcccgccacggccgcctaccgtgaggtgtggcaggtg
aacctgaagcccaagggtctgggccagagcaagaacctgacgggggtgtaccgtctgtgc
ctgtctgcgcgcaccatcggcttcgtgaagctcaactgcgagcagccgtcggtgacgctg
cagctcatgaacatccgccgctgcggccactcggacagcttcttcttcatcgaggtgggc
cgctcggccgtcacaggccccggcgagctgtggatgcaggcggacgactcggtggtggcg
cagaacatccacgagaccatcctggaggccatgaaggcgctcaaggagctcttcgagttc
cggccgcgcagtaagagccaatcgtcggggtcgtcggccacgcaccccatcagcgtcccc
ggcgcgcgccgccaccaccacctggtcaacctgccccccagccagacgggcctggtgcgc
cgctcgcgcaccgacagcctggccgccaccccgccggcggccaagtgcagctcgtgccgg
gtgcgcaccgccagcgagggcgacggcggcgcggcggcgggagcggcggccgcgggcgcc
aggccggtgtcggtggctgggagccccctgagccccgggccggtgcgcgcgcccctgagc
cgctcgcacaccctgagcggcggctgcggcggccgcgggagcaaggtggcgctgctgccg
gcagggggcgcgctgcaacacagccgctccatgtccatgcccgtggcgcactcgccgccc
gccgccaccagccccggctccctgtcgtccagcagcggccacggctcgggctcctacccg
ccgccgcccggcccgcacccgcctctgccgcatccgctgcaccacggccccggccagcgg
ccctccagcggcagcgcctccgcctcgggctcccccagcgaccccggcttcatgtccctg
gacgagtacggctccagcccaggcgacctgcgcgccttctgcagccaccgaagcaacacg
cccgagtccatcgcggagacgcccccggcccgagacggcggcggcggcggtgagttctac
gggtacatgaccatggacaggcccctgagccactgtggccgctcctaccgccgggtctcg
ggggacgcggcccaggacctggaccgagggctgcgcaagaggacctactccctgaccacg
ccagcccggcagcggccggtgccccagccctcctctgcctcgctggatgaatacaccctg
atgcgggccaccttctcgggcagcgcgggccgcctctgcccgtcctgccccgcgtcctct
cccaaggtggcctaccacccctacccagaggactacggagacatcgagatcggctcccac
aggagctccagcagcaacctgggggcagacgacggctacatgcccatgacgcccggcgcg
gccctcgcgggcagtgggagcggcagctgcaggagcgacgactacatgcccatgagcccc
gccagcgtgtccgcccccaagcagatcttgcagcccagggccgccgccgccgccgccgcc
gccgtgccttctgcggggcctgcggggccagcacccacctctgcggcgggcaggacattc
ccggcgagcgggggcggctacaaggccagctcgcccgccgagagctcccccgaggacagt
gggtacatgcgcatgtggtgcggttccaagctgtccatggagcatgcagatggcaagctg
ctgcccaacggggactacctcaacgtgtcccccagcgacgcggtcaccacgggcaccccg
cccgacttcttctccgcagccctgcaccccggcggggagccgctcaggggcgttcccggc
tgctgctacagctccttgccccgctcctacaaggccccctacacctgtggcggggacagc
gaccagtacgtgctcatgagctcccccgtggggcgcatcctggaggaggagcgtctggag
cctcaggccacgccagggcccagccaggcggccagcgccttcggggccggccccacgcag
ccccctcaccctgtagtgccttcgcccgtgcggcctagcggcggccgcccggagggcttc
ttgggccagcgcggccgggcggtgaggcccacgcgcctgtccctggaggggctgcccagc
ctgcccagcatgcacgagtacccactgccaccggagcccaagagccccggcgagtacatc
aacatcgactttggcgagcccggggcccgcctgtcgccgcccgcgcctcccctgctggcg
tcggcggcctcgtcctcctcgctcttgtccgccagcagcccggcctcgtcgctgggctca
ggcaccccgggcaccagcagcgacagccggcagcggtctccgctctccgactacatgaac
ctcgacttcagctcccccaagtctcctaagccgggcgccccgagcggccaccccgtgggc
tccttggacggcctcctgtcccccgaggcctcctccccgtatccgccgttgcccccgcgt
ccgtccgcgtccccgtcgtcgtctctgcagccgccgccaccgccgccggccccgggggag
ctgtaccgcctgccccccgcctcggccgttgccaccgcccagggcccgggcgccgcctca
tcgttgtcctcggacaccggggacaatggtgactacaccgagatggcttttggtgtggcc
gccaccccgccgcaacctatcgcggcccccccgaagccagaagctgcccgcgtggccagc
ccgacgtcgggcgtgaagaggctgagcctcatggagcaggtgtcgggagtcgaggccttc
ctgcaggccagccagcccccggacccccaccgcggcgccaaggtcatccgcgcagacccg
caggggggccgccgccgccacagttccgagaccttctcctccaccacgacggtcaccccc
gtgtccccgtccttcgcccacaaccccaagcgccacaactcggcctccgtggaaaatgtc
tctctcaggaaaagcagcgagggcggcgtgggtgtcggccctggagggggcgacgagccg
cccacctccccacgacagttgcagccggcgccccctttggcaccgcagggccggccgtgg
accccgggtcagcccgggggcttggtcggttgtcctgggagcggtggatcgcccatgcgc
agagagacctctgccggcttccagaatggtctcaactacatcgccatcgacgtgagggag
gagcccgggctgccaccccagccgcagccgccgccgccgccgcttcctcagccgggagac
aagagctcctggggccggacccgaagcctcgggggtctcatcagcgctgtgggcgtcggc
agcaccggcggcgggtgcggggggccgggtcccggtgccctgccccctgccaacacctac
gccagcattgacttcttgtcccaccacttgaaggaggccaccatcgtgaaagagtga

DBGET integrated database retrieval system