KEGG   Homo sapiens (human): 8662Help
Entry
8662              CDS       T01001                                 

Gene name
EIF3B, EIF3-ETA, EIF3-P110, EIF3-P116, EIF3S9, PRT1
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8662 (EIF3B)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    8662 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p22.3
AA seq 814 aa AA seqDB search
MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEA
GPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSR
AQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcggagaacgtggcggtgcccgaggcggccgaggagcgcgccgagcccggc
cagcagcagccggccgccgagccgccgccagccgaggggctgctgcggcccgcggggccc
ggcgctccggaggccgcggggaccgaggcctccagtgaggaggtggggatcgcggaggcc
gggccggagtccgaggtgaggaccgagccggcggccgaggcagaggcggcctccggcccg
tccgagtcgccctcgccgccggccgccgaggagctgcccgggtcgcatgctgagccccct
gtcccggcacagggcgaggccccaggagagcaggctcgggacgagcgctccgacagccgg
gcccaggcggtgtccgaggacgcgggaggaaacgagggcagagcggccgaggccgaaccc
cgggcgctggagaacggcgacgcggacgagccctccttcagcgaccccgaggacttcgtg
gacgacgtgagcgaggaagaattactgggagatgtactcaaagatcggccccaggaagca
gatggaatcgattcggtgattgtagtggacaatgtccctcaggtgggacccgaccgactt
gagaaactcaaaaatgtcatccacaagatcttttccaagtttgggaaaatcacaaatgat
ttttatcctgaagaggatgggaagacaaaagggtatattttcctggagtacgcgtcccct
gcccacgctgtggatgctgtgaagaacgccgacggctacaagcttgacaagcagcacaca
ttccgggtcaacctctttacggattttgacaagtatatgacgatcagtgacgagtgggat
attccagagaaacagcctttcaaagacctggggaacttacgttactggcttgaagaggca
gaatgcagagatcagtacagtgtgatttttgagagtggagaccgcacttccatattctgg
aatgacgtaaaagaccctgtctcaattgaagaaagagcgagatggacagagacgtatgtg
cgttggtctcctaagggcacctacctggctacctttcatcaaagaggcattgctctatgg
gggggagagaaattcaagcaaattcagagattcagccaccaaggggttcagcttattgac
ttctcaccttgtgaaaggtacctggtgacctttagccccctgatggacacgcaggatgac
cctcaggccataatcatctgggacatccttacggggcacaagaagaggggttttcactgt
gagagctcagcccattggcctatttttaagtggagccatgatggcaaattctttgccaga
atgaccctggatacgcttagcatctatgaaactccttctatgggtcttttggacaagaag
agtttgaagatctctgggataaaagacttttcttggtctcctggtggtaacataatcgcc
ttctgggtgcctgaagacaaagatattccagccagggtaaccctgatgcagctccctacc
aggcaagagatccgagtgaggaacctgttcaatgtggtggactgcaagctccattggcag
aagaacggagactacttgtgtgtgaaagtagataggactccgaaaggcacccagggtgtt
gtcacaaattttgaaattttccgaatgagggagaaacaggtacctgtggatgtggtcgag
atgaaagaaaccatcatagcctttgcctgggaaccaaatggaagtaagtttgctgtgctg
cacggagaggctccgcggatatctgtgtctttctaccacgtcaaaaacaacgggaagatt
gaactcatcaagatgttcgacaagcagcaggcgaacaccatcttctggagcccccaagga
cagttcgtggtgttggcgggcctgaggagtatgaacggtgccttagcgtttgtggacact
tcggactgcacggtcatgaacatcgcagagcactacatggcttccgacgtcgaatgggat
cctactgggcgctacgtcgtcacctctgtgtcctggtggagccataaggtggacaacgcg
tactggctgtggactttccagggacgcctcctgcagaagaacaacaaggaccgcttctgc
cagctgctgtggcggccccggcctcccacactcctgagccaggaacagatcaagcaaatt
aaaaaggatctgaagaaatactctaagatctttgaacagaaggatcgtttgagtcagtcc
aaagcctcaaaggaattggtggagagaaggcgcaccatgatggaagatttccggaagtac
cggaaaatggcccaggagctctatatggagcagaaaaacgagcgcctggagttgcgagga
ggggtggacactgacgagctggacagcaacgtggacgactgggaagaggagaccattgag
ttcttcgtcactgaagaaatcattcccctcgggaatcaggagtga

DBGET integrated database retrieval system