KEGG   Homo sapiens (human): 8669Help
Entry
8669              CDS       T01001                                 

Gene name
EIF3J, EIF3S1, eIF3-alpha, eIF3-p35
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8669 (EIF3J)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    8669 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21.1
AA seq 204 aa AA seqDB search
MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKK
EEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRL
KKLQEESDLELAKETFVEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKA
TMKDDLADYGGYDGGYVQDYEDFM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcgggggactcggactcctgggacgccgacgctttctcc
gtggaagacccagtgcggaaggtggggggcggcggcactgccggcggggaccgctgggaa
ggcgaggacgaggacgaggacgtcaaggataactgggatgacgatgatgatgaaaaaaaa
gaggaagcagaagtaaaaccagaggtaaaaatttcagaaaagaaaaaaatagcagagaag
ataaaagagaaagaacggcaacagaagaaaaggcaagaagaaattaaaaagaggttagaa
gaacccgaagaacctaaagtgctaacaccagaagaacaattagcagataaactgcggcta
aagaaattacaggaagagtcagacctcgaattagcaaaggaaacttttgtggaaattgat
gacttgaaaaaaattaccaattcactgactgtgctttgcagtgaaaaacagaagcaagaa
aagcaaagcaaagccaaaaagaagaagaaaggtgtggttcctggagggggattaaaagcc
accatgaaagatgatctggcagattatggtggttatgatggaggatatgtacaagactat
gaagacttcatgtga

DBGET integrated database retrieval system