KEGG   Homo sapiens (human): 8672Help
Entry
8672              CDS       T01001                                 

Gene name
EIF4G3, eIF-4G_3, eIF4G_3, eIF4GII
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma 3
  KO
K03260  
translation initiation factor 4G
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Viral myocarditis
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8672 (EIF4G3)
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    8672 (EIF4G3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     8672 (EIF4G3)
   mRNA cycle factors
    Stress granule specific factors
     8672 (EIF4G3)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    8672 (EIF4G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.12
AA seq 1585 aa AA seqDB search
MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPV
PQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQ
SAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTP
PQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVLS
GEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAAPTSSALSSQPIFTTAIDDR
CELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLVSSTNLINEIN
GVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQ
TEEILDSQNLNSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKV
LESEQDKMSQGFHPERDPSDLKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSS
GDGVTFPFKPESWKPTDTEGKKQYDREFLLDFQFMPACIQKPEGLPPISDVVLDKINQPK
LPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSV
KEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGL
TVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELF
KLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIV
KERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTK
EKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSS
GGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEFDSRRTLTSRGSMGREKNDKP
LPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRE
SAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYL
AELVTPMLKEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREAD
LSWKDFLPEGEDVHNFLLEQKLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKAN
DEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAAIIADSSTFRVDTAVIKQRVPILLKYL
DSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNG
KGVALKSVTAFFTWLREAEEESEDN
NT seq 4758 nt NT seq  +upstreamnt  +downstreamnt
atgaattcacaacctcaaacccgttctccgtttttccagaggcctcaaatacagcctcct
agagctaccatcccgaacagcagtccttccattcgtcctggtgcacagacacccactgca
gtgtaccaggctaatcagcacatcatgatggttaaccatctgcccatgccgtacccagtg
ccccaggggcctcagtactgtataccacagtaccgtcatagtggccctccttatgttggg
cccccccaacaatatccagttcaaccaccggggccaggtcctttttatcctggaccagga
cctggggacttccccaatgcttatggaacgcctttttacccaagtcagccggtgtatcag
tcagcacctatcatagtgcctacgcagcaacagccgcctccagccaagagagagaaaaaa
actataagaattcgggatccaaaccagggaggtaaagacataacagaggagattatgtct
ggaggtggcagcagaaatcctactccacccataggaagacccacgtccacacctactcct
cctcagcagctgcccagccaggtccccgagcacagccctgtggtttatgggactgtggag
agcgctcatcttgctgccagcacccctgtcactgcagctagcgaccagaagcaagaggag
aagccaaaaccagatccagtgttaaagtctccttccccagtccttaggctagtcctcagt
ggagagaagaaagaacaagaaggccagacatctgaaactactgcaatagtatccatagca
gagcttcctctgcctccatcacctaccactgtttcttctgttgctcgaagtacaattgca
gcccccacctcttctgctcttagtagccaaccaatattcaccactgctatagatgacaga
tgtgaactctcatccccaagagaagacacaattcctatacccagcctcacatcttgcaca
gaaacatcagaccctttaccaacaaatgaaaatgatgatgatatatgcaagaaaccctgt
agtgtagcacctaatgatattccactggtttctagtactaacctaattaatgaaataaat
ggagttagcgaaaaattatcagccacggagagcattgtggaaatagtaaaacaggaagta
ttgccattgactcttgaattggagattctcgaaaatcccccagaagaaatgaaactggag
tgtatcccagctcccatcaccccttccacagttccttcctttcctccaactcctccaact
cctccagcttctcctcctcacactccagtcattgttcctgctgctgccactactgttagt
tctccgagtgctgccatcacagtccagagagtcctagaggaggacgagagcataagaact
tgccttagtgaagatgcaaaagagattcagaacaaaatagaggtagaagcagatgggcaa
acagaagagattttggattctcaaaacttaaattcaagaaggagccctgtcccagctcaa
atagctataactgtaccaaagacatggaagaaaccaaaagatcggacccgaaccactgaa
gagatgttagaggcagaattggagcttaaagctgaagaggagctttccattgacaaagta
cttgaatctgaacaagataaaatgagccaggggtttcatcctgaaagagacccctctgac
ctaaaaaaagtgaaagctgtggaagaaaatggagaagaagctgagccagtacgtaatggt
gctgagagtgtttctgagggtgaaggaatagatgctaattcaggctccacagatagttct
ggtgatggggttacatttccatttaaaccagaatcctggaagcctactgatactgaaggt
aagaagcagtatgacagggagtttctgctggacttccagttcatgcctgcctgtatacaa
aaaccagagggcctgcctcctatcagtgatgtggttcttgacaagatcaaccaacccaaa
ttgccaatgcgaactctggatcctcgaattttgcctcgaggaccagactttacaccagcc
tttgctgattttggaaggcagacacctggtggaagaggcgtacctttgttgaatgttggg
tcacgaagatctcaacctggccaaagaagagaacccagaaagatcatcacagtttctgta
aaagaagatgtacacctgaaaaaggcagaaaatgcctggaagccaagccaaaaacgagac
agccaagccgatgatcccgaaaacattaaaacccaggagctttttagaaaagttcgaagt
atcttaaataaattgacaccacagatgttcaatcaactgatgaagcaagtgtcaggactt
actgttgacacagaggagcggctgaaaggagttattgacctggtctttgagaaggctatt
gatgaacccagtttctctgtggcttacgcaaacatgtgtcgatgtctagtaacgctgaaa
gtacccatggcagacaagcctggtaacacagtgaatttccggaagctgctactgaaccgt
tgccagaaggagtttgaaaaagataaagcagatgatgatgtctttgagaagaagcagaaa
gaacttgaggctgccagtgctccagaggagaggacaaggcttcatgatgaactggaagaa
gccaaggacaaagcccggcggagatccattggcaacatcaagtttattggagaactcttt
aaactcaaaatgctgactgaagccatcatgcatgactgtgtggtgaagctgctaaagaac
catgatgaagaatccctggagtgcctgtgtcgcctgctcaccaccattggcaaagacttg
gactttgaaaaagcaaagccacgtatggaccagtactttaatcagatggagaaaattgtg
aaagaaagaaaaacctcatctaggattcggttcatgcttcaagatgttatagacctaagg
ctgtgcaattgggtatctcgaagagcagatcaagggcctaaaactatcgaacagattcac
aaagaggctaaaatagaagaacaagaagagcaaaggaaggtccagcaactcatgaccaaa
gagaagagaagaccaggtgtccagagagtggacgaaggtgggtggaacactgtacaaggg
gccaagaacagtcgggtactggacccctcaaaattcctaaaaatcactaagcctacaatt
gatgaaaaaattcagctggtacctaaagcacagctaggcagctggggaaaaggcagcagt
ggtggagcaaaggcaagtgagactgatgccttacggtcaagtgcttccagtttaaacaga
ttctctgccctgcaacctccagcaccctcagggtccacgccatccacgcctgtagagttt
gattcccgaaggaccttaactagtcgtggaagtatgggcagggagaagaatgacaagccc
cttccatctgcaacagctcggccaaatactttcatgaggggtggcagcagtaaagacctg
ctagacaatcagtctcaagaagagcagcggagagagatgctggagaccgtgaagcagctc
acaggaggtgtggatgtggagaggaacagcactgaggctgagcgaaataaaacaagggag
tcagcaaaaccagaaatttcagcaatgtcagctcatgacaaggctgcattatcagaagag
gaactggagaggaagtcgaaatctatcattgatgaatttctacacattaatgattttaag
gaagccatgcagtgtgtggaagagctgaatgcccagggcctactacatgtttttgtgaga
gtgggagtggagtccaccctggaaaggagccagatcaccagggatcacatgggccaatta
ctctatcagctggtacagtcagaaaaactcagcaaacaggactttttcaaaggtttttca
gaaactttggaattggcagatgacatggccattgatattccccatatttggttgtacctt
gctgaactggtgacccccatgttaaaagaaggtggaatctccatgagagaacttaccata
gaatttagcaaacctttacttcctgttggaagagctggggtcttgctatctgaaatattg
cacctactatgcaaacaaatgagccataagaaagtgggagccttatggagggaggctgac
ctcagctggaaggactttttaccagaaggagaagatgtacataattttcttttggagcag
aagttggacttcatagagtctgacagtccctgttcctctgaagcactttcaaagaaagaa
ctgtctgccgaagagctgtataagcgactcgagaaactcattattgaggacaaagcgaat
gatgaacagatctttgactgggtagaggctaatctagacgaaatccagatgagttcacct
acattccttagagctttaatgactgctgtttgtaaagcagctattatagccgactcttct
accttcagagtggacactgctgttatcaagcagagagtgccgatcttactcaagtaccta
gactcagatacagagaaggaactgcaagcactttatgcactacaagcatcgatagtaaaa
cttgatcaacctgccaatttgctgcggatgttttttgattgtctatatgacgaggaggtg
atctccgaggatgccttctacaaatgggagagcagcaaggaccctgcagagcagaatggg
aagggcgtggctctgaaatctgtcacggcattcttcacgtggctgcgggaagcagaagag
gagtctgaggataactaa

DBGET integrated database retrieval system