KEGG   Homo sapiens (human): 8673Help
Entry
8673              CDS       T01001                                 

Gene name
VAMP8, EDB, VAMP-8
Definition
(RefSeq) vesicle associated membrane protein 8
  KO
K08512  
vesicle-associated membrane protein 8
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8673 (VAMP8)
 Organismal Systems
  Immune system
   04611 Platelet activation
    8673 (VAMP8)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    8673 (VAMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p12-p11.2
AA seq 100 aa AA seqDB search
MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKT
TSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagccagtgaaggtggaggaaatgatcgtgtgcggaacctgcaaagtgaggtg
gagggagttaagaatattatgacccagaatgtggagcggatcctggcccggggggaaaac
ttggaacatctccgcaacaagacagaggatctggaagccacatctgagcacttcaagacg
acatcgcagaaggtggctcgaaaattctggtggaagaacgtgaagatgattgtccttatc
tgcgtgattgtttttatcatcatcctcttcattgtgctctttgccactggtgccttctct
taa

DBGET integrated database retrieval system