KEGG   Homo sapiens (human): 8676Help
Entry
8676              CDS       T01001                                 

Gene name
STX11, FHL4, HLH4, HPLH4
Definition
syntaxin 11
Orthology
K08487  
syntaxin 11
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Disease
H00109  
Familial hemophagocytic lymphohistiocytosis (FHPL)
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6q24.2
AA seq 287 aa AA seqDB search
MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVA
DVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGP
HSAVARISRAQYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDM
FEQGKWDVFSENLLADVKGARAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQAD
TLNVIELNVQKTVDYTGQAKAQVRKAVQYEEKNPCRTLCCFCCPCLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaccggctagcagaacttctggacttgtccaagcaatatgaccagcagttccca
gacggggacgatgagtttgactcgccccacgaggacatcgtgttcgagacggaccacatc
ctggagtccctgtaccgagacatccgggacattcaggatgaaaaccagctgctggtggcc
gacgtgaagcggctgggaaagcagaacgcccgcttcctcacgtccatgcggcgcctcagc
agcatcaagcgcgacaccaactccatcgccaaggccatcaaggcccggggcgaggtcatc
cactgcaagctgcgcgccatgaaggagctgagcgaggcggctgaggcccagcacggcccg
cactcggcagtggcgcgcatttcgcgggcgcagtacaacgcgctcaccctcaccttccag
cgcgccatgcacgactacaaccaggccgagatgaagcagcgcgacaactgcaagatccgc
atccagcgccagctggagatcatgggcaaggaagtctcgggcgaccagatcgaggacatg
ttcgagcagggtaagtgggacgtgttttccgagaacttgctggccgacgtgaagggcgcg
cgggccgccctcaacgagatcgagagccgccaccgcgaactgctgcgcctggagagccgc
atccgcgacgtacacgagctcttcttgcagatggcggtgctggtggagaagcaggccgac
accctgaacgtcatcgagctcaacgtacaaaagacggtcgactacaccggccaggccaag
gcgcaggtgcggaaggccgtgcagtacgaggagaagaacccctgccggaccctctgctgc
ttctgctgtccctgcctcaagtag

DBGET integrated database retrieval system