KEGG   Homo sapiens (human): 868Help
Entry
868               CDS       T01001                                 

Gene name
CBLB, Cbl-b, RNF56
Definition
Cbl proto-oncogene B, E3 ubiquitin protein ligase
Orthology
K04707  
E3 ubiquitin-protein ligase CBL [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
Jak-STAT signaling pathway
T cell receptor signaling pathway
Insulin signaling pathway
Bacterial invasion of epithelial cells
Measles
Pathways in cancer
Proteoglycans in cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    868 (CBLB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    868 (CBLB)
   04630 Jak-STAT signaling pathway
    868 (CBLB)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    868 (CBLB)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    868 (CBLB)
  Endocrine system
   04910 Insulin signaling pathway
    868 (CBLB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    868 (CBLB)
   05205 Proteoglycans in cancer
    868 (CBLB)
   05220 Chronic myeloid leukemia
    868 (CBLB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    868 (CBLB)
   05162 Measles
    868 (CBLB)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     868 (CBLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.11
AA seq 982 aa AA seqDB search
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactcaatgaatggcagaaaccctggtggtcgaggaggaaatccccgaaaaggt
cgaattttgggtattattgatgctattcaggatgcagttggaccccctaagcaagctgcc
gcagatcgcaggaccgtggagaagacttggaagctcatggacaaagtggtaagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatatatacttgatattttgcctgat
acatatcagcatttacgacttatattgagtaaatatgatgacaaccagaaacttgcccaa
ctcagtgagaatgagtactttaaaatctacattgatagccttatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagagaatgtatgaagaacagtcacaggacaga
cgaaatctcacaaaactgtcccttatcttcagtcacatgctggcagaaatcaaagcaatc
tttcccaatggtcaattccagggagataactttcgtatcacaaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactatcgtaccatggaaagtattcagacagtgc
cttcatgaggtccaccagattagctctggcctggaagcaatggctctaaaatcaacaatt
gatttaacttgcaatgattacatttcagtttttgaatttgatatttttaccaggctgttt
cagccttggggctctattttgcggaattggaatttcttagctgtgacacatccaggttac
atggcatttctcacatatgatgaagttaaagcacgactacagaaatatagcaccaaaccc
ggaagctatattttccggttaagttgcactcgattgggacagtgggccattggctatgtg
actggggatgggaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattttatctttatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacacctcatgaccatataaaagttacacaggaacaatat
gaattatattgtgaaatgggctccacttttcagctctgtaagatttgtgcagagaatgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacggcatgg
caggagtcggatggtcagggctgccctttctgtcgttgtgaaataaaaggaactgagccc
ataatcgtggacccctttgatccaagagatgaaggctccaggtgttgcagcatcattgac
ccctttggcatgccgatgctagacttggacgacgatgatgatcgtgaggagtccttgatg
atgaatcggttggcaaacgtccgaaagtgcactgacaggcagaactcaccagtcacatca
ccaggatcctctccccttgcccagagaagaaagccacagcctgacccactccagatccca
catctaagcctgccacccgtgcctcctcgcctggatctaattcagaaaggcatagttaga
tctccctgtggcagcccaacgggttcaccaaagtcttctccttgcatggtgagaaaacaa
gataaaccactcccagcaccacctcctcccttaagagatcctcctccaccgccacctgaa
agacctccaccaatcccaccagacaatagactgagtagacacatccatcatgtggaaagc
gtgccttccagagacccgccaatgcctcttgaagcatggtgccctcgggatgtgtttggg
actaatcagcttgtgggatgtcgactcctaggggagggctctccaaaacctggaatcaca
gcgagttcaaatgtcaatggaaggcacagtagagtgggctctgacccagtgcttatgcgg
aaacacagacgccatgatttgcctttagaaggagctaaggtcttttccaatggtcacctt
ggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagttaccaccctc
ctccctagcataaagtgtactggtccgttagcaaattctctttcagagaaaacaagagac
ccagtagaggaagatgatgatgaatacaagattccttcatcccaccctgtttccctgaat
tcacaaccatctcattgtcataatgtaaaacctcctgttcggtcttgtgataatggtcac
tgtatgctgaatggaacacatggtccatcttcagagaagaaatcaaacatccctgactta
agcatatatttaaagggagatgtttttgattcagcctctgatcccgtgccattaccacct
gccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccctct
gattatgatcttctcatccctccattaggtgaagatgcttttgatgccctccctccatct
ctcccacctcccccacctcctgcaaggcatagtctcattgaacattcaaaacctcctggc
tccagtagccggccatcctcaggacaggatctttttcttcttccttcagatccctttgtt
gatctagcaagtggccaagttcctttgcctcctgctagaaggttaccaggtgaaaatgtc
aaaactaacagaacatcacaggactatgatcagcttccttcatgttcagatggttcacag
gcaccagccagaccccctaaaccacgaccgcgcaggactgcaccagaaattcaccacaga
aaaccccatgggcctgaggcggcattggaaaatgtcgatgcaaaaattgcaaaactcatg
ggagagggttatgcctttgaagaggtgaagagagccttagagatagcccagaataatgtc
gaagttgcccggagcatcctccgagaatttgccttccctcctccagtatccccacgtcta
aatctatag

DBGET integrated database retrieval system