KEGG   Homo sapiens (human): 8682Help
Entry
8682              CDS       T01001                                 

Gene name
PEA15, HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED
Definition
(RefSeq) phosphoprotein enriched in astrocytes 15
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 130 aa AA seqDB search
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtacgggaccctcctgcaagacctgaccaacaacatcacccttgaagatcta
gaacagctcaagtcggcctgcaaggaagacatccccagcgaaaagagtgaggagatcact
actggcagtgcctggtttagcttcctggagagccacaacaagctggacaaagacaacctc
tcctacattgagcacatctttgagatctcccgccgtcctgacctactcactatggtggtt
gactacagaacccgtgtgctgaagatctctgaggaggatgagctggacaccaagctaacc
cgtatccccagtgccaagaagtacaaagacattatccggcagccctctgaggaagagatc
atcaaattggctcccccaccgaagaaggcctga

DBGET integrated database retrieval system