KEGG   Homo sapiens (human): 8683Help
Entry
8683              CDS       T01001                                 

Gene name
SRSF9, SFRS9, SRp30c
Definition
serine/arginine-rich splicing factor 9
Orthology
K12890  
splicing factor, arginine/serine-rich 1/9
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 221 aa AA seqDB search
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctgggcggacgagcgcggcggcgagggcgacgggcgcatctacgtggggaac
cttccgaccgacgtgcgcgagaaggacttggaggacctgttctacaagtacggccgcatc
cgcgagatcgagctcaagaaccggcacggcctcgtgcccttcgccttcgtgcgcttcgag
gacccccgagatgcagaggatgctatttatggaagaaatggttatgattatggccagtgt
cggcttcgtgtggagttccccaggacttatggaggtcggggtgggtggccccgtggtggg
aggaatgggcctcctacaagaagatctgatttccgagttcttgtttcaggacttcctccg
tcaggcagctggcaggacctgaaggatcacatgcgagaagctggggatgtctgttatgct
gatgtgcagaaggatggagtggggatggtcgagtatctcagaaaagaagacatggaatat
gccctgcgtaaactggatgacaccaaattccgctctcatgagggtgaaacttcctacatc
cgagtttatcctgagagaagcaccagctatggctactcacggtctcggtctgggtcaagg
ggccgtgactctccataccaaagcaggggttccccacactacttctctcctttcaggccc
tactga

DBGET integrated database retrieval system