KEGG   Homo sapiens (human): 8692Help
Entry
8692              CDS       T01001                                 

Gene name
HYAL2, LUCA2
Definition
hyaluronoglucosaminidase 2 (EC:3.2.1.35)
Orthology
K01197  
hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Module
Dermatan sulfate degradation
Chondroitin sulfate degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 473 aa AA seqDB search
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcaggcccaggccccaccgttacattggccctggtgctggcggtgtcatgggcc
atggagctcaagcccacagcaccacccatcttcactggccggccctttgtggtagcgtgg
gacgtgcccacacaggactgtggcccacgcctcaaggtgccactggacctgaatgccttt
gatgtgcaggcctcacctaatgagggttttgtgaaccagaatattaccatcttctaccgc
gaccgtctaggcctgtatccacgcttcgattctgccggaaggtctgtgcatggtggtgtg
ccacagaatgtcagcctttgggcacaccggaagatgctgcagaaacgtgtggagcactac
attcggacacaggagtctgcggggctggcggtcatcgactgggaggactggcgacctgtg
tgggtgcgcaactggcaggacaaagatgtgtatcgccggttatcacgccagctagtggcc
agtcgtcaccctgactggcctccagaccgcatagtcaaacaggcacaatatgagtttgag
ttcgcagcacagcagttcatgctggagacactgcgttatgtcaaggcagtgcggccccgg
cacctctggggcttctacctctttcctgactgctacaatcatgattatgtgcagaactgg
gagagctacacaggccgctgccctgatgttgaggtggcccgcaatgaccagctggcctgg
ctgtgggctgagagcacggccctcttcccgtctgtctacctggacgagacacttgcttcc
tcccgccatggccgcaactttgtgagcttccgtgttcaggaggcccttcgtgtggctcgc
acccaccatgccaaccatgcactcccagtctacgtcttcacacgacccacctacagccgc
aggctcacggggcttagtgagatggacctcatctctaccattggcgagagtgcggccctg
ggcgcagctggtgtcatcctctggggtgacgcggggtacaccacaagcacggagacctgc
cagtacctcaaagattacctgacacggctgctggtcccctacgtggtcaatgtgtcctgg
gccacccaatattgcagccgggcccagtgccatggccatgggcgctgtgtgcgccgcaac
cccagtgccagtaccttcctgcatctcagcaccaacagtttccgcctagtgcctggccat
gcacctggtgaaccccagctgcgacctgtgggggagctcagttgggccgacattgaccac
ctgcagacacacttccgctgccagtgctacttgggctggagtggtgagcaatgccagtgg
gaccataggcaggcagctggaggtgccagcgaggcctgggctgggtcccacctcaccagt
ctgctggctctggcagccctggcctttacctggaccttgtag

DBGET integrated database retrieval system