KEGG   Homo sapiens (human): 8697Help
Entry
8697              CDS       T01001                                 

Gene name
CDC23, ANAPC8, APC8, CUT23
Definition
cell division cycle 23
Orthology
K03355  
anaphase-promoting complex subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8697 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8697 (CDC23)
   04114 Oocyte meiosis
    8697 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8697 (CDC23)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    8697 (CDC23)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     8697 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31
AA seq 597 aa AA seqDB search
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtacctccatggtcccggtggctgtgacggcggcagtggcgcctgtcctg
tccataaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttacccgggagcggggcctactacacagtagcaaatggtcggcggagttggctttc
tctctccctgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaagat
gcccaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggcgcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggttaaagaggccattgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcgtatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacgtgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactaatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcttatagacatgccattgaggtcaacaaacgggactacaga
gcttggtatggcctcgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgcctttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcatttaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagactcctaccaccgaggtgcctgctccctttttcctacctgcttcactctctgctaac
aatacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

DBGET integrated database retrieval system