KEGG   Homo sapiens (human): 8702Help
Entry
8702              CDS       T01001                                 

Gene name
B4GALT4, B4Gal-T4, beta4Gal-T4
Definition
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 (EC:2.4.1.90 2.4.1.275)
Orthology
K07969  
beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    8702 (B4GALT4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    8702 (B4GALT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     8702 (B4GALT4)
    2.4.1.-  
     8702 (B4GALT4)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   8702 (B4GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.3
AA seq 344 aa AA seqDB search
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKG
KTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKA
LQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAE
RMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaacctgactttccacctttcctacaaattccgattactgttgctgttgact
ttgtgcctgacagtggttgggtgggccaccagtaactacttcgtgggtgccattcaagag
attcctaaagcaaaggagttcatggctaatttccataagaccctcattttggggaaggga
aaaactctgactaatgaagcatccacgaagaaggtagaacttgacaactgcccttctgtg
tctccttacctcagaggccagagcaagctcattttcaaaccagatctcactttggaagag
gtacaggcagaaaatcccaaagtgtccagaggccggtatcgccctcaggaatgtaaagct
ttacagagggtcgccatcctcgttccccaccggaacagagagaaacacctgatgtacctg
ctggaacatctgcatcccttcctgcagaggcagcagctggattatggcatctacgtcatc
caccaggctgaaggtaaaaagtttaatcgagccaaactcttgaatgtgggctatctagaa
gccctcaaggaagaaaattgggactgctttatattccacgatgtggacctggtacccgag
aatgactttaacctttacaagtgtgaggagcatcccaagcatctggtggttggcaggaac
agcactgggtacaggttacgttacagtggatattttgggggtgttactgccctaagcaga
gagcagtttttcaaggtgaatggattctctaacaactactggggatggggaggcgaagac
gatgacctcagactcagggttgagctccaaagaatgaaaatttcccggcccctgcctgaa
gtgggtaaatatacaatggtcttccacactagagacaaaggcaatgaggtgaacgcagaa
cggatgaagctcttacaccaagtgtcacgagtctggagaacagatgggttgagtagttgt
tcttataaattagtatctgtggaacacaatcctttatatatcaacatcacagtggatttc
tggtttggtgcatga

DBGET integrated database retrieval system