KEGG   Homo sapiens (human): 8714Help
Entry
8714              CDS       T01001                                 

Gene name
ABCC3, ABC31, EST90757, MLP2, MOAT-D, MRP3, cMOAT2
Definition
(RefSeq) ATP binding cassette subfamily C member 3
  KO
K05667  
ATP-binding cassette, subfamily C (CFTR/MRP), member 3
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    8714 (ABCC3)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    8714 (ABCC3)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    8714 (ABCC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 1527 aa AA seqDB search
MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHC
RGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLAT
LLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFAL
VLSALILACFREKPPFFSAKNVDPNPYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDL
WSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNASGEDEVLLGARPRPRKPSFL
KALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCS
MMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQ
MKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWM
CSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLK
RIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVV
GPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRY
QQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSA
VDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQ
KQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW
DYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGI
LQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVD
EVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLE
SVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVE
FVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVG
IVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTL
RMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARAL
LRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGV
VAEFDSPANLIAARGIFYGMARDAGLA
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atggacgccctgtgcggttccggggagctcggctccaagttctgggactccaacctgtct
gtgcacacagaaaacccggacctcactccctgcttccagaactccctgctggcctgggtg
ccctgcatctacctgtgggtcgccctgccctgctacttgctctacctgcggcaccattgt
cgtggctacatcatcctctcccacctgtccaagctcaagatggtcctgggtgtcctgctg
tggtgcgtctcctgggcggaccttttttactccttccatggcctggtccatggccgggcc
cctgcccctgttttctttgtcacccccttggtggtgggggtcaccatgctgctggccacc
ctgctgatacagtatgagcggctgcagggcgtacagtcttcgggggtcctcattatcttc
tggttcctgtgtgtggtctgcgccatcgtcccattccgctccaagatccttttagccaag
gcagagggtgagatctcagaccccttccgcttcaccaccttctacatccactttgccctg
gtactctctgccctcatcttggcctgcttcagggagaaacctccatttttctccgcaaag
aatgtcgaccctaacccctaccctgagaccagcgctggctttctctcccgcctgtttttc
tggtggttcacaaagatggccatctatggctaccggcatcccctggaggagaaggacctc
tggtccctaaaggaagaggacagatcccagatggtggtgcagcagctgctggaggcatgg
aggaagcaggaaaagcagacggcacgacacaaggcttcagcagcacctgggaaaaatgcc
tccggcgaggacgaggtgctgctgggtgcccggcccaggccccggaagccctccttcctg
aaggccctgctggccaccttcggctccagcttcctcatcagtgcctgcttcaagcttatc
caggacctgctctccttcatcaatccacagctgctcagcatcctgatcaggtttatctcc
aaccccatggccccctcctggtggggcttcctggtggctgggctgatgttcctgtgctcc
atgatgcagtcgctgatcttacaacactattaccactacatctttgtgactggggtgaag
tttcgtactgggatcatgggtgtcatctacaggaaggctctggttatcaccaactcagtc
aaacgtgcgtccactgtgggggaaattgtcaacctcatgtcagtggatgcccagcgcttc
atggaccttgcccccttcctcaatctgctgtggtcagcacccctgcagatcatcctggcg
atctacttcctctggcagaacctaggtccctctgtcctggctggagtcgctttcatggtc
ttgctgattccactcaacggagctgtggccgtgaagatgcgcgccttccaggtaaagcaa
atgaaattgaaggactcgcgcatcaagctgatgagtgagatcctgaacggcatcaaggtg
ctgaagctgtacgcctgggagcccagcttcctgaagcaggtggagggcatcaggcagggt
gagctccagctgctgcgcacggcggcctacctccacaccacaaccaccttcacctggatg
tgcagccccttcctggtgaccctgatcaccctctgggtgtacgtgtacgtggacccaaac
aatgtgctggacgccgagaaggcctttgtgtctgtgtccttgtttaatatcttaagactt
cccctcaacatgctgccccagttaatcagcaacctgactcaggccagtgtgtctctgaaa
cggatccagcaattcctgagccaagaggaacttgacccccagagtgtggaaagaaagacc
atctccccaggctatgccatcaccatacacagtggcaccttcacctgggcccaggacctg
ccccccactctgcacagcctagacatccaggtcccgaaaggggcactggtggccgtggtg
gggcctgtgggctgtgggaagtcctccctggtgtctgccctgctgggagagatggagaag
ctagaaggcaaagtgcacatgaagggctccgtggcctatgtgccccagcaggcatggatc
cagaactgcactcttcaggaaaacgtgcttttcggcaaagccctgaaccccaagcgctac
cagcagactctggaggcctgtgccttgctagctgacctggagatgctgcctggtggggat
cagacagagattggagagaagggcattaacctgtctgggggccagcggcagcgggtcagt
ctggctcgagctgtttacagtgatgccgatattttcttgctggatgacccactgtccgcg
gtggactctcatgtggccaagcacatctttgaccacgtcatcgggccagaaggcgtgctg
gcaggcaagacgcgagtgctggtgacgcacggcattagcttcctgccccagacagacttc
atcattgtgctagctgatggacaggtgtctgagatgggcccgtacccagccctgctgcag
cgcaacggctcctttgccaactttctctgcaactatgcccccgatgaggaccaagggcac
ctggaggacagctggaccgcgttggaaggtgcagaggataaggaggcactgctgattgaa
gacacactcagcaaccacacggatctgacagacaatgatccagtcacctatgtggtccag
aagcagtttatgagacagctgagtgccctgtcctcagatggggagggacagggtcggcct
gtaccccggaggcacctgggtccatcagagaaggtgcaggtgacagaggcgaaggcagat
ggggcactgacccaggaggagaaagcagccattggcactgtggagctcagtgtgttctgg
gattatgccaaggccgtggggctctgtaccacgctggccatctgtctcctgtatgtgggt
caaagtgcggctgccattggagccaatgtgtggctcagtgcctggacaaatgatgccatg
gcagacagtagacagaacaacacttccctgaggctgggcgtctatgctgctttaggaatt
ctgcaagggttcttggtgatgctggcagccatggccatggcagcgggtggcatccaggct
gcccgtgtgttgcaccaggcactgctgcacaacaagatacgctcgccacagtccttcttt
gacaccacaccatcaggccgcatcctgaactgcttctccaaggacatctatgtcgttgat
gaggttctggcccctgtcatcctcatgctgctcaattccttcttcaacgccatctccact
cttgtggtcatcatggccagcacgccgctcttcactgtggtcatcctgcccctggctgtg
ctctacaccttagtgcagcgcttctatgcagccacatcacggcaactgaagcggctggaa
tcagtcagccgctcacctatctactcccacttttcggagacagtgactggtgccagtgtc
atccgggcctacaaccgcagccgggattttgagatcatcagtgatactaaggtggatgcc
aaccagagaagctgctacccctacatcatctccaaccggtggctgagcatcggagtggag
ttcgtggggaactgcgtggtgctctttgctgcactatttgccgtcatcgggaggagcagc
ctgaacccggggctggtgggcctttctgtgtcctactccttgcaggtgacatttgctctg
aactggatgatacgaatgatgtcagatttggaatctaacatcgtggctgtggagagggtc
aaggagtactccaagacagagacagaggcgccctgggtggtggaaggcagccgccctccc
gaaggttggcccccacgtggggaggtggagttccggaattattctgtgcgctaccggccg
ggcctagacctggtgctgagagacctgagtctgcatgtgcacggtggcgagaaggtgggg
atcgtgggccgcactggggctggcaagtcttccatgaccctttgcctgttccgcatcctg
gaggcggcaaagggtgaaatccgcattgatggcctcaatgtggcagacatcggcctccat
gacctgcgctctcagctgaccatcatcccgcaggaccccatcctgttctcggggaccctg
cgcatgaacctggaccccttcggcagctactcagaggaggacatttggtgggctttggag
ctgtcccacctgcacacgtttgtgagctcccagccggcaggcctggacttccagtgctca
gagggcggggagaatctcagcgtgggccagaggcagctcgtgtgcctggcccgagccctg
ctccgcaagagccgcatcctggttttagacgaggccacagctgccatcgacctggagact
gacaacctcatccaggctaccatccgcacccagtttgatacctgcactgtcctgaccatc
gcacaccggcttaacactatcatggactacaccagggtcctggtcctggacaaaggagta
gtagctgaatttgattctccagccaacctcattgcagctagaggcatcttctacgggatg
gccagagatgctggacttgcctaa

DBGET integrated database retrieval system