KEGG   Homo sapiens (human): 8718Help
Entry
8718              CDS       T01001                                 

Gene name
TNFRSF25, APO-3, DDR3, DR3, LARD, TNFRSF12, TR3, TRAMP, WSL-1, WSL-LR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 25
  KO
K05160  
tumor necrosis factor receptor superfamily member 25
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8718 (TNFRSF25)
Cytokine receptors [BR:hsa04050]
 TNF receptor family
  8718 (TNFRSF25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.2
AA seq 417 aa AA seqDB search
MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAP
CTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPG
WFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCP
TSTLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTADEAG
MEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNSWTPGYPETQEALCPQVTWSW
DQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEFVRTLGLREAE
IEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcggccgcggggctgcgcggcggtggcggcggcgctcctcctggtgctgctg
ggggcccgggcccagggcggcactcgtagccccaggtgtgactgtgccggtgacttccac
aagaagattggtctgttttgttgcagaggctgcccagcggggcactacctgaaggcccct
tgcacggagccctgcggcaactccacctgccttgtgtgtccccaagacaccttcttggcc
tgggagaaccaccataattctgaatgtgcccgctgccaggcctgtgatgagcaggcctcc
caggtggcgctggagaactgttcagcagtggccgacacccgctgtggctgtaagccaggc
tggtttgtggagtgccaggtcagccaatgtgtcagcagttcacccttctactgccaacca
tgcctagactgcggggccctgcaccgccacacacggctactctgttcccgcagagatact
gactgtgggacctgcctgcctggcttctatgaacatggcgatggctgcgtgtcctgcccc
acgagcaccctggggagctgtccagagcgctgtgccgctgtctgtggctggaggcagatg
ttctgggtccaggtgctcctggctggccttgtggtccccctcctgcttggggccaccctg
acctacacataccgccactgctggcctcacaagcccctggttactgcagatgaagctggg
atggaggctctgaccccaccaccggccacccatctgtcacccttggacagcgcccacacc
cttctagcacctcctgacagcagtgagaagatctgcaccgtccagttggtgggtaacagc
tggacccctggctaccccgagacccaggaggcgctctgcccgcaggtgacatggtcctgg
gaccagttgcccagcagagctcttggccccgctgctgcgcccacactctcgccagagtcc
ccagccggctcgccagccatgatgctgcagccgggcccgcagctctacgacgtgatggac
gcggtcccagcgcggcgctggaaggagttcgtgcgcacgctggggctgcgcgaggcagag
atcgaagccgtggaggtggagatcggccgcttccgagaccagcagtacgagatgctcaag
cgctggcgccagcagcagcccgcgggcctcggagccgtttacgcggccctggagcgcatg
gggctggacggctgcgtggaagacttgcgcagccgcctgcagcgcggcccgtga

DBGET integrated database retrieval system