KEGG   Homo sapiens (human): 8718Help
Entry
8718              CDS       T01001                                 

Gene name
TNFRSF25, APO-3, DDR3, DR3, LARD, TNFRSF12, TR3, TRAMP, WSL-1, WSL-LR
Definition
tumor necrosis factor receptor superfamily, member 25
Orthology
K05160  
tumor necrosis factor receptor superfamily member 25
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.2
AA seq 181 aa AA seqDB search
MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAP
CTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPG
WFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCP
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcggccgcggggctgcgcggcggtggcggcggcgctcctcctggtgctgctg
ggggcccgggcccagggcggcactcgtagccccaggtgtgactgtgccggtgacttccac
aagaagattggtctgttttgttgcagaggctgcccagcggggcactacctgaaggcccct
tgcacggagccctgcggcaactccacctgccttgtgtgtccccaagacaccttcttggcc
tgggagaaccaccataattctgaatgtgcccgctgccaggcctgtgatgagcaggcctcc
caggtggcgctggagaactgttcagcagtggccgacacccgctgtggctgtaagccaggc
tggtttgtggagtgccaggtcagccaatgtgtcagcagttcacccttctactgccaacca
tgcctagactgcggggccctgcaccgccacacacggctactctgttcccgcagagatact
gactgtgggacctgcctgcctggcttctatgaacatggcgatggctgcgtgtcctgcccc
acgtaa

DBGET integrated database retrieval system