KEGG   Homo sapiens (human): 8731Help
Entry
8731              CDS       T01001                                 

Gene name
RNMT, CMT1, CMT1c, MET, RG7MT1, cm1p, hCMT1, hMet
Definition
(RefSeq) RNA guanine-7 methyltransferase (EC:2.1.1.56)
  KO
K00565  
mRNA (guanine-N7-)-methyltransferase [EC:2.1.1.56]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    8731 (RNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.56  mRNA (guanine-N7)-methyltransferase
     8731 (RNMT)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     8731 (RNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.21
AA seq 476 aa AA seqDB search
MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRK
EFEDDLVKESSSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTG
DGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMK
SVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRY
EDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMM
LRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDF
NLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP
YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattctgcaaaagcagaagaatatgaaaagatgtctcttgaacaggcaaaagcg
tcagtgaattctgaaacagagtcttcattcaatattaatgaaaacacaacagcttctggg
actgggctttctgaaaagacttctgtctgtaggcaagtagacatagcaagaaagagaaaa
gagtttgaagatgatcttgtaaaggaaagttctagttgtgggaaagacactccatccaag
aagagaaaacttgatcctgaaattgtcccagaggaaaaagattgtggtgatgctgaaggc
aattcaaagaaaagaaaaagagaaactgaggatgttccaaaagataaatcttctactgga
gatggcactcaaaataagagaaaaatagcacttgaggatgttcctgaaaagcagaaaaat
ctggaagaaggacacagctcaacagtggctgcccattacaatgaacttcaggaagttggt
ttggagaagcgtagtcaaagtcgtattttttacctaagaaactttaataattggatgaaa
agtgttctcattggagaatttttggaaaaggtacgacagaagaaaaaacgtgatatcact
gttttggacctgggatgtggtaaaggtggagatttgctgaaatggaaaaaaggaagaatt
aacaagctagtttgtactgatattgccgatgtttctgtcaaacagtgtcagcagcggtat
gaggacatgaaaaatcgtcgtgatagtgaatatattttcagtgcagaatttataactgct
gacagctcaaaggaacttctgattgacaaatttcgtgacccacaaatgtgttttgacatc
tgcagttgtcagtttgtctgtcattactcatttgagtcttatgagcaggctgacatgatg
ctgagaaatgcgtgtgagagacttagccctgggggctattttattggtactactcccaat
agctttgaattgataagacgccttgaagcttcagaaacagaatcatttggaaatgaaata
tatactgtgaaatttcagaagaaaggagattatcctttatttggctgcaaatatgacttc
aacttggaaggtgttgtggatgttcctgaattcttggtctattttccattgctaaatgaa
atggcaaagaagtacaatatgaaactagtctacaaaaaaacatttctggaattctacgaa
gaaaagattaagaacaatgaaaataaaatgctcttaaaacgaatgcaggccttggagcca
tatcctgcaaatgagagttctaaacttgtctctgagaaggtggatgactatgaacatgca
gcaaagtacatgaagaacagtcaagtaaggttacctttgggaaccttaagtaaatcagaa
tgggaagctacaagtatttacttggtgtttgcctttgagaaacagcagtga

DBGET integrated database retrieval system