KEGG   Homo sapiens (human): 8732Help
Entry
8732              CDS       T01001                                 

Gene name
RNGTT, CAP1A, HCE, HCE1, hCAP
Definition
RNA guanylyltransferase and 5'-phosphatase (EC:2.7.7.50 3.1.3.33)
Orthology
K13917  
mRNA-capping enzyme [EC:2.7.7.50 3.1.3.33]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    8732 (RNGTT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.50  mRNA guanylyltransferase
     8732 (RNGTT)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.33  polynucleotide 5'-phosphatase
     8732 (RNGTT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q16
AA seq 574 aa AA seqDB search
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVK
MGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPE
LIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKG
VTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICT
SRKKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKV
TKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFID
RCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaacaagatcccgccgcggtggctgaactgtccccggcgcggccagccggtg
gcaggaagattcttacctctgaagacaatgttaggaccaagatatgatagtcaagttgct
gaagaaaatcggttccatcccagcatgctctcaaattacctaaagagcctaaaggttaaa
atgggcttgttggtggacctgacaaatacttcaaggttctatgaccgaaatgacatagaa
aaagaaggaatcaaatatataaaacttcagtgtaaaggacatggtgagtgccctaccact
gagaatactgagacctttattcgtctgtgtgagcggtttaatgaaagaaatccacctgaa
cttataggtgttcattgtactcatggcttcaatcgcactggtttcctcatatgtgccttt
ttggtggagaaaatggattggagtatcgaagcagcagttgctacttttgcccaagccaga
ccaccaggaatctacaagggtgattatttgaaggaactttttcgtcggtatggtgacata
gaggaagcaccacccccacctctattgccagattggtgttttgaggatgatgaagacgaa
gatgaggatgaggatggaaagaaggaatcagaacccgggtcaagtgcttcttttggcaaa
aggagaaaagaacggttaaaactgggcgctattttcttggaaggtgttactgttaaaggt
gtaactcaagtaacaacacaaccaaagttaggagaggtacagcagaagtgtcatcaattc
tgtggctgggaagggtctggattccctggagcacagcctgtttccatggacaagcaaaat
attaaacttttagacctgaagccatacaaagtaagctggaaagcagatggtactcggtac
atgatgttgattgatggcacaaatgaagtttttatgattgatagagacaattcagtattt
catgtttcaaatctggaatttccatttcgtaaagatcttcgtatgcatttatcaaatact
ctcttggatggcgagatgattattgacagagtaaatggacaggctgttcctagatatttg
atatatgacataattaaattcaattcacagcccgttggagattgtgattttaatgttcgt
ctgcagtgtatagaacgagaaattataagtcctcgacacgaaaaaatgaagactgggctc
attgacaaaacacaggaaccatttagcgtcagaaataagccgttttttgacatctgtact
tcaagaaagaaatacaaacctggtcgatgtgatgatattttgaaatggaagcctcccagt
ctgaattctgtggattttcgtctaaaaataacaagaatgggaggagaagggttacttcct
cagaatgttggcctcctgtatgttggaggttatgaaagaccctttgcacaaatcaaggtg
acaaaagagctgaaacagtatgacaacaaaattatagaatgcaaatttgagaacaacagc
tgggtcttcatgagacagagaacagacaaaagttttcctaatgcctacaacactgccatg
gctgtgtgtaacagcatctcaaaccctgtcaccaaggagatgctgtttgagttcatcgac
agatgtactgcagcttctcaaggacagaagcgaaaacatcatctggaccctgacacggag
ctcatgccaccaccacctcccaaaagaccacgccctttaacctaa

DBGET integrated database retrieval system