KEGG   Homo sapiens (human): 8733Help
Entry
8733              CDS       T01001                                 

Gene name
GPAA1, GAA1, hGAA1
Definition
(RefSeq) glycosylphosphatidylinositol anchor attachment 1
  KO
K05289  
glycosylphosphatidylinositol transamidase
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    8733 (GPAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 621 aa AA seqDB search
MGLLSDPVRRRALARLVLRLNAPLCVLSYVAGIAWFLALVFPPLTQRTYMSENAMGSTMV
EEQFAGGDRARAFARDFAAHRKKSGALPVAWLERTMRSVGLEVYTQSFSRKLPFPDETHE
RYMVSGTNVYGILRAPRAASTESLVLTVPCGSDSTNSQAVGLLLALAAHFRGQIYWAKDI
VFLVTEHDLLGTEAWLEAYHDVNVTGMQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVE
GLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPLQGLQTLLLMVLRQASG
RPHGSHGLFLRYRVEALTLRGINSFRQYKYDLVAVGKALEGMFRKLNHLLERLHQSFFLY
LLPGLSRFVSIGLYMPAVGFLLLVLGLKALELWMQLHEAGMGLEEPGGAPGPSVPLPPSQ
GVGLASLVAPLLISQAMGLALYVLPVLGQHVATQHFPVAEAEAVVLTLLAIYAAGLALPH
NTHRVVSTQAPDRGWMALKLVALIYLALQLGCIALTNFSLGFLLATTMVPTAALAKPHGP
RTLYAALLVLTSPAATLLGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLF
PLLSLGLYPCWLLFWNVLFWK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcctgtcggacccggttcgccggcgcgcgctcgcccgcctagtgctgcgcctc
aacgcgccgttgtgcgtgctgagctacgtggcgggcatcgcctggttcttggcgctggtt
ttcccgccgctgacccagcgcacttacatgtcggagaacgccatgggctccaccatggtg
gaggagcagtttgcgggcggagaccgtgcccgggcttttgcccgggacttcgccgcccac
cgcaagaagtcgggggctctgccagtggcctggcttgaacggacgatgcggtcagtaggg
ctggaggtctacacgcagagtttctcccggaaactgcccttcccagatgagacccacgag
cgctatatggtgtcgggcaccaacgtgtacggcatcctgcgggccccgcgtgctgccagc
accgagtcgcttgtgctcaccgtgccctgtggctctgactctaccaacagccaggctgtg
gggctgctgctggcactggctgcccacttccgggggcagatttattgggccaaagatatc
gtcttcctggtaacagaacatgaccttctgggcactgaggcttggcttgaagcctaccac
gatgtcaatgtcactggcatgcagtcgtctcccctgcagggccgagctggggccattcag
gcagccgtggccctggagctgagcagtgatgtggtcaccagcctcgatgtggccgtggag
gggcttaacgggcagctgcccaaccttgacctgctcaatctcttccagaccttctgccag
aaagggggcctgttgtgcacgcttcagggcaagctgcagcccgaggactggacatcattg
gatggaccgctgcagggcctgcagacactgctgctcatggttctgcggcaggcctccggc
cgcccccacggctcccatggcctcttcctgcgctaccgtgtggaggccctaaccctgcgt
ggcatcaatagcttccgccagtacaagtatgacctggtggcagtgggcaaggctttggag
ggcatgttccgcaagctcaaccacctcctggagcgcctgcaccagtccttcttcctctac
ttgctccccggcctctcccgcttcgtctccatcggcctctacatgcccgctgtcggcttc
ttgctcctggtccttggtctcaaggctctggaactgtggatgcagctgcatgaggctgga
atgggccttgaggagcccgggggtgcccctggccccagtgtaccccttcccccatcacag
ggtgtggggctggcctcgctcgtggcacctctgctgatctcacaggccatgggactggcc
ctctatgtcctgccagtgctgggccaacacgttgccacccagcacttcccagtggcagag
gctgaggctgtggtgctgacactgctggcgatttatgcagctggcctggccctgccccac
aatacccaccgggtggtaagcacacaggccccagacaggggctggatggcactgaagctg
gtagccctgatctacctagcactgcagctgggctgcatcgccctcaccaacttctcactg
ggcttcctgctggccaccaccatggtgcccactgctgcgcttgccaagcctcatgggccc
cggaccctctatgctgccctgctggtgctgaccagcccggcagccacgctccttggcagc
ctgttcctgtggcgggagctgcaggaggcgccactgtcactggccgagggctggcagctc
ttcctggcagcgctagcccagggtgtgctggagcaccacacctacggcgccctgctcttc
ccactgctgtccctgggcctctacccctgctggctgcttttctggaatgtgctcttctgg
aagtga

DBGET integrated database retrieval system