KEGG   Homo sapiens (human): 8737Help
Entry
8737              CDS       T01001                                 

Gene name
RIPK1, RIP, RIP1
Definition
receptor (TNFRSF)-interacting serine-threonine kinase 1 (EC:2.7.11.1)
Orthology
K02861  
receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Hepatitis C
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8737 (RIPK1)
   04668 TNF signaling pathway
    8737 (RIPK1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8737 (RIPK1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    8737 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    8737 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    8737 (RIPK1)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    8737 (RIPK1)
   05169 Epstein-Barr virus infection
    8737 (RIPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8737 (RIPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  RIPK family [OT]
   8737 (RIPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p25.2
AA seq 671 aa AA seqDB search
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagacatgtccttgaatgtcattaagatgaaatccagtgacttcctggagagt
gcagaactggacagcggaggctttgggaaggtgtctctgtgtttccacagaacccaggga
ctcatgatcatgaaaacagtgtacaaggggcccaactgcattgagcacaacgaggccctc
ttggaggaggcgaagatgatgaacagactgagacacagccgggtggtgaagctcctgggc
gtcatcatagaggaagggaagtactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctgaaagccgagatgagtactccgctttctgtaaaaggaaggataattttg
gaaatcattgaaggaatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgataatgacttccacattaagatcgcagacctcggccttgcc
tcctttaagatgtggagcaaactgaataatgaagagcacaatgagctgagggaagtggac
ggcaccgctaagaagaatggcggcaccctctactacatggcgcccgagcacctgaatgac
gtcaacgcaaagcccacagagaagtcggatgtgtacagctttgctgtagtactctgggcg
atatttgcaaataaggagccatatgaaaatgctatctgtgagcagcagttgataatgtgc
ataaaatctgggaacaggccagatgtggatgacatcactgagtactgcccaagagaaatt
atcagtctcatgaagctctgctgggaagcgaatccggaagctcggccgacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattagaagaaagtgtagaagaggac
gtgaagagtttaaagaaagagtattcaaacgaaaatgcagttgtgaagagaatgcagtct
cttcaacttgattgtgtggcagtaccttcaagccggtcaaattcagccacagaacagcct
ggttcactgcacagttcccagggacttgggatgggtcctgtggaggagtcctggtttgct
ccttccctggagcacccacaagaagagaatgagcccagcctgcagagtaaactccaagac
gaagccaactaccatctttatggcagccgcatggacaggcagacgaaacagcagcccaga
cagaatgtggcttacaacagagaggaggaaaggagacgcagggtctcccatgaccctttt
gcacagcaaagaccttacgagaattttcagaatacagagggaaaaggcactgcttattcc
agtgcagccagtcatggtaatgcagtgcaccagccctcagggctcaccagccaacctcaa
gtactgtatcagaacaatggattatatagctcacatggctttggaacaagaccactggat
ccaggaacagcaggtcccagagtttggtacaggccaattccaagtcatatgcctagtctg
cataatatcccagtgcctgagaccaactatctaggaaatacacccaccatgccattcagc
tccttgccaccaacagatgaatctataaaatataccatatacaatagtactggcattcag
attggagcctacaattatatggagattggtgggacgagttcatcactactagacagcaca
aatacgaacttcaaagaagagccagctgctaagtaccaagctatctttgataataccact
agtctgacggataaacacctggacccaatcagggaaaatctgggaaagcactggaaaaac
tgtgcccgtaaactgggcttcacacagtctcagattgatgaaattgaccatgactatgag
cgagatggactgaaagaaaaggtttaccagatgctccaaaagtgggtgatgagggaaggc
ataaagggagccacggtggggaagctggcccaggcgctccaccagtgttccaggatcgac
cttctgagcagcttgatttacgtcagccagaactaa

DBGET integrated database retrieval system