KEGG   Homo sapiens (human): 8737Help
Entry
8737              CDS       T01001                                 

Gene name
RIPK1, RIP, RIP1
Definition
receptor (TNFRSF)-interacting serine-threonine kinase 1 (EC:2.7.11.1)
Orthology
K02861  
receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Hepatitis C
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p25.2
AA seq 671 aa AA seqDB search
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagacatgtccttgaatgtcattaagatgaaatccagtgacttcctggagagt
gcagaactggacagcggaggctttgggaaggtgtctctgtgtttccacagaacccaggga
ctcatgatcatgaaaacagtgtacaaggggcccaactgcattgagcacaacgaggccctc
ttggaggaggcgaagatgatgaacagactgagacacagccgggtggtgaagctcctgggc
gtcatcatagaggaagggaagtactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctgaaagccgagatgagtactccgctttctgtaaaaggaaggataattttg
gaaatcattgaaggaatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgataatgacttccacattaagatcgcagacctcggccttgcc
tcctttaagatgtggagcaaactgaataatgaagagcacaatgagctgagggaagtggac
ggcaccgctaagaagaatggcggcaccctctactacatggcgcccgagcacctgaatgac
gtcaacgcaaagcccacagagaagtcggatgtgtacagctttgctgtagtactctgggcg
atatttgcaaataaggagccatatgaaaatgctatctgtgagcagcagttgataatgtgc
ataaaatctgggaacaggccagatgtggatgacatcactgagtactgcccaagagaaatt
atcagtctcatgaagctctgctgggaagcgaatccggaagctcggccgacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattagaagaaagtgtagaagaggac
gtgaagagtttaaagaaagagtattcaaacgaaaatgcagttgtgaagagaatgcagtct
cttcaacttgattgtgtggcagtaccttcaagccggtcaaattcagccacagaacagcct
ggttcactgcacagttcccagggacttgggatgggtcctgtggaggagtcctggtttgct
ccttccctggagcacccacaagaagagaatgagcccagcctgcagagtaaactccaagac
gaagccaactaccatctttatggcagccgcatggacaggcagacgaaacagcagcccaga
cagaatgtggcttacaacagagaggaggaaaggagacgcagggtctcccatgaccctttt
gcacagcaaagaccttacgagaattttcagaatacagagggaaaaggcactgcttattcc
agtgcagccagtcatggtaatgcagtgcaccagccctcagggctcaccagccaacctcaa
gtactgtatcagaacaatggattatatagctcacatggctttggaacaagaccactggat
ccaggaacagcaggtcccagagtttggtacaggccaattccaagtcatatgcctagtctg
cataatatcccagtgcctgagaccaactatctaggaaatacacccaccatgccattcagc
tccttgccaccaacagatgaatctataaaatataccatatacaatagtactggcattcag
attggagcctacaattatatggagattggtgggacgagttcatcactactagacagcaca
aatacgaacttcaaagaagagccagctgctaagtaccaagctatctttgataataccact
agtctgacggataaacacctggacccaatcagggaaaatctgggaaagcactggaaaaac
tgtgcccgtaaactgggcttcacacagtctcagattgatgaaattgaccatgactatgag
cgagatggactgaaagaaaaggtttaccagatgctccaaaagtgggtgatgagggaaggc
ataaagggagccacggtggggaagctggcccaggcgctccaccagtgttccaggatcgac
cttctgagcagcttgatttacgtcagccagaactaa

DBGET integrated database retrieval system