KEGG   Homo sapiens (human): 8741Help
Entry
8741              CDS       T01001                                 

Gene name
TNFSF13, APRIL, CD256, TALL-2, TALL2, TRDL-1, ZTNF2
Definition
tumor necrosis factor (ligand) superfamily, member 13
Orthology
K05475  
tumor necrosis factor ligand superfamily member 13
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Intestinal immune network for IgA production
Rheumatoid arthritis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8741 (TNFSF13)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    8741 (TNFSF13)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    8741 (TNFSF13)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     8741 (TNFSF13)
Cellular antigens [BR:hsa04090]
 Proteins
  8741 (TNFSF13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 223 aa AA seqDB search
MPASSPFLLAPKGPPGNMGGPVREPALSVALWLSWGAALGAVACAMALLTQQTELQSLRR
EVSRLQGTGGPSQNGEGYPWQSLPEQQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRG
LQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRA
YNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccagcctcatctcctttcttgctagcccccaaagggcctccaggcaacatggggggc
ccagtcagagagccggcactctcagttgccctctggttgagttggggggcagctctgggg
gccgtggcttgtgccatggctctgctgacccaacaaacagagctgcagagcctcaggaga
gaggtgagccggctgcaggggacaggaggcccctcccagaatggggaagggtatccctgg
cagagtctcccggagcagcagcactctgtcctgcacctggttcccattaacgccacctcc
aaggatgactccgatgtgacagaggtgatgtggcaaccagctcttaggcgtgggagaggc
ctacaggcccaaggatatggtgtccgaatccaggatgctggagtttatctgctgtatagc
caggtcctgtttcaagacgtgactttcaccatgggtcaggtggtgtctcgagaaggccaa
ggaaggcaggagactctattccgatgtataagaagtatgccctcccacccggaccgggcc
tacaacagctgctatagcgcaggtgtcttccatttacaccaaggggatattctgagtgtc
ataattccccgggcaagggcgaaacttaacctctctccacatggaaccttcctggggttt
gtgaaactgtga

DBGET integrated database retrieval system