KEGG   Homo sapiens (human): 8742Help
Entry
8742              CDS       T01001                                 

Gene name
TNFSF12, APO3L, DR3LG, TWEAK
Definition
tumor necrosis factor (ligand) superfamily, member 12
Orthology
K05474  
tumor necrosis factor ligand superfamily member 12
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8742 (TNFSF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13
AA seq 249 aa AA seqDB search
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEEL
VAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQD
GAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLD
LLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL
TYFGLFQVH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccgtcggagccagaggcggagggggcgccggggggagccgggcaccgccctg
ctggtcccgctcgcgctgggcctgggcctggcgctggcctgcctcggcctcctgctggcc
gtggtcagtttggggagccgggcatcgctgtccgcccaggagcctgcccaggaggagctg
gtggcagaggaggaccaggacccgtcggaactgaatccccagacagaagaaagccaggat
cctgcgcctttcctgaaccgactagttcggcctcgcagaagtgcacctaaaggccggaaa
acacgggctcgaagagcgatcgcagcccattatgaagttcatccacgacctggacaggac
ggagcgcaggcaggtgtggacgggacagtgagtggctgggaggaagccagaatcaacagc
tccagccctctgcgctacaaccgccagatcggggagtttatagtcacccgggctgggctc
tactacctgtactgtcaggtgcactttgatgaggggaaggctgtctacctgaagctggac
ttgctggtggatggtgtgctggccctgcgctgcctggaggaattctcagccactgcggcg
agttccctcgggccccagctccgcctctgccaggtgtctgggctgttggccctgcggcca
gggtcctccctgcggatccgcaccctcccctgggcccatctcaaggctgcccccttcctc
acctacttcggactcttccaggttcactga

DBGET integrated database retrieval system