KEGG   Homo sapiens (human): 8744Help
Entry
8744              CDS       T01001                                 

Gene name
TNFSF9, 4-1BB-L, CD137L, TNLG5A
Definition
(RefSeq) TNF superfamily member 9
  KO
K05472  tumor necrosis factor ligand superfamily member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8744 (TNFSF9)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8744 (TNFSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Albumin_I
Motif
Other DBs
NCBI-GeneID: 8744
NCBI-ProteinID: NP_003802
OMIM: 606182
HGNC: 11939
Ensembl: ENSG00000125657
Vega: OTTHUMG00000181831
Pharos: P41273(Tbio)
UniProt: P41273 A0A0U5J8I0
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 254 aa AA seqDB search
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA
SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL
TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA
LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV
TPEIPAGLPSPRSE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgcctctgacgcttcactggaccccgaagccccgtggcctcccgcgccccgc
gctcgcgcctgccgcgtactgccttgggccctggtcgcggggctgctgctgctgctgctg
ctcgctgccgcctgcgccgtcttcctcgcctgcccctgggccgtgtccggggctcgcgcc
tcgcccggctccgcggccagcccgagactccgcgagggtcccgagctttcgcccgacgat
cccgccggcctcttggacctgcggcagggcatgtttgcgcagctggtggcccaaaatgtt
ctgctgatcgatgggcccctgagctggtacagtgacccaggcctggcaggcgtgtccctg
acggggggcctgagctacaaagaggacacgaaggagctggtggtggccaaggctggagtc
tactatgtcttctttcaactagagctgcggcgcgtggtggccggcgagggctcaggctcc
gtttcacttgcgctgcacctgcagccactgcgctctgctgctggggccgccgccctggct
ttgaccgtggacctgccacccgcctcctccgaggctcggaactcggccttcggtttccag
ggccgcttgctgcacctgagtgccggccagcgcctgggcgtccatcttcacactgaggcc
agggcacgccatgcctggcagcttacccagggcgccacagtcttgggactcttccgggtg
acccccgaaatcccagccggactcccttcaccgaggtcggaataa

DBGET integrated database retrieval system