KEGG   Homo sapiens (human): 8744Help
Entry
8744              CDS       T01001                                 

Gene name
TNFSF9, 4-1BB-L, CD137L
Definition
tumor necrosis factor (ligand) superfamily, member 9
Orthology
K05472  
tumor necrosis factor ligand superfamily member 9
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 254 aa AA seqDB search
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA
SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL
TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA
LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV
TPEIPAGLPSPRSE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgcctctgacgcttcactggaccccgaagccccgtggcctcccgcgccccgc
gctcgcgcctgccgcgtactgccttgggccctggtcgcggggctgctgctgctgctgctg
ctcgctgccgcctgcgccgtcttcctcgcctgcccctgggccgtgtccggggctcgcgcc
tcgcccggctccgcggccagcccgagactccgcgagggtcccgagctttcgcccgacgat
cccgccggcctcttggacctgcggcagggcatgtttgcgcagctggtggcccaaaatgtt
ctgctgatcgatgggcccctgagctggtacagtgacccaggcctggcaggcgtgtccctg
acggggggcctgagctacaaagaggacacgaaggagctggtggtggccaaggctggagtc
tactatgtcttctttcaactagagctgcggcgcgtggtggccggcgagggctcaggctcc
gtttcacttgcgctgcacctgcagccactgcgctctgctgctggggccgccgccctggct
ttgaccgtggacctgccacccgcctcctccgaggctcggaactcggccttcggtttccag
ggccgcttgctgcacctgagtgccggccagcgcctgggcgtccatcttcacactgaggcc
agggcacgccatgcctggcagcttacccagggcgccacagtcttgggactcttccgggtg
acccccgaaatcccagccggactcccttcaccgaggtcggaataa

DBGET integrated database retrieval system