KEGG   Homo sapiens (human): 875Help
Entry
875               CDS       T01001                                 

Gene name
CBS, HIP4
Definition
(RefSeq) cystathionine-beta-synthase
  KO
K01697  
cystathionine beta-synthase [EC:4.2.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Methionine degradation
Cysteine biosynthesis, homocysteine + serine => cysteine
Disease
H00183  
Homocystinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    875 (CBS)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    875 (CBS)
   00270 Cysteine and methionine metabolism
    875 (CBS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     875 (CBS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P35520(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 551 aa AA seqDB search
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPA
SESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD
RISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDV
LRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTT
YEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKA
AQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLS
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLL
NFVAAQERDQK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgagaccccccaggcagaagtggggcccacaggctgcccccaccgctcaggg
ccacactcggcgaaggggagcctggagaaggggtccccagaggataaggaagccaaggag
cccctgtggatccggcccgatgctccgagcaggtgcacctggcagctgggccggcctgcc
tccgagtccccacatcaccacactgccccggcaaaatctccaaaaatcttgccagatatt
ctgaagaaaatcggggacacccctatggtcagaatcaacaagattgggaagaagttcggc
ctgaagtgtgagctcttggccaagtgtgagttcttcaacgcgggcgggagcgtgaaggac
cgcatcagcctgcggatgattgaggatgctgagcgcgacgggacgctgaagcccggggac
acgattatcgagccgacatccgggaacaccgggatcgggctggccctggctgcggcagtg
aggggctatcgctgcatcatcgtgatgccagagaagatgagctccgagaaggtggacgtg
ctgcgggcactgggggctgagattgtgaggacgcccaccaatgccaggttcgactccccg
gagtcacacgtgggggtggcctggcggctgaagaacgaaatccccaattctcacatccta
gaccagtaccgcaacgccagcaaccccctggctcactacgacaccaccgctgatgagatc
ctgcagcagtgtgatgggaagctggacatgctggtggcttcagtgggcacgggcggcacc
atcacgggcattgccaggaagctgaaggagaagtgtcctggatgcaggatcattggggtg
gatcccgaagggtccatcctcgcagagccggaggagctgaaccagacggagcagacaacc
tacgaggtggaagggatcggctacgacttcatccccacggtgctggacaggacggtggtg
gacaagtggttcaagagcaacgatgaggaggcgttcacctttgcccgcatgctgatcgcg
caagaggggctgctgtgcggtggcagtgctggcagcacggtggcggtggccgtgaaggcc
gcgcaggagctgcaggagggccagcgctgcgtggtcattctgcccgactcagtgcggaac
tacatgaccaagttcctgagcgacaggtggatgctgcagaagggctttctgaaggaggag
gacctcacggagaagaagccctggtggtggcacctccgtgttcaggagctgggcctgtca
gccccgctgaccgtgctcccgaccatcacctgtgggcacaccatcgagatcctccgggag
aagggcttcgaccaggcgcccgtggtggatgaggcgggggtaatcctgggaatggtgacg
cttgggaacatgctctcgtccctgcttgccgggaaggtgcagccgtcagaccaagttggc
aaagtcatctacaagcagttcaaacagatccgcctcacggacacgctgggcaggctctcg
cacatcctggagatggaccacttcgccctggtggtgcacgagcagatccagtaccacagc
accgggaagtccagtcagcggcagatggtgttcggggtggtcaccgccattgacttgctg
aacttcgtggccgcccaggagcgggaccagaagtga

DBGET integrated database retrieval system