KEGG   Homo sapiens (human): 8763Help
Entry
8763              CDS       T01001                                 

Gene name
CD164, DFNA66, MGC-24, MGC-24v, MUC-24, endolyn
Definition
(RefSeq) CD164 molecule
  KO
K06546  CD164 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    8763 (CD164)
CD molecules [BR:hsa04090]
 Proteins
  8763 (CD164)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGC-24 DUF4366 PHD_Oberon
Motif
Other DBs
NCBI-GeneID: 8763
NCBI-ProteinID: NP_006007
OMIM: 603356
HGNC: 1632
Ensembl: ENSG00000135535
Vega: OTTHUMG00000015339
Pharos: Q04900(Tbio)
UniProt: Q04900
Position
6q21
AA seq 197 aa AA seqDB search
MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPET
CEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTA
NSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVI
FFLYKFCKSKERNYHTL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggctctcccgctcactgctttgggccgccacctgcctgggcgtgctctgcgtg
ctgtccgcggacaagaacacgacccagcacccgaacgtgacgactttagcgcccatctcc
aacgtaacctcggcgccggtgacgtccctcccgctggtcaccactccggcaccagaaacc
tgtgaaggtcgaaacagctgcgtttcctgttttaatgttagcgttgttaatactacctgc
ttttggatagaatgtaaagatgagagctattgttcacataactcaacagttagtgattgt
caagtggggaacacgacagacttctgttccgtttccacggccactccagtgccaacagcc
aattctacagctaaacccacagttcagccctccccttctacaacttccaagacagttact
acatcaggtacaacaaataacactgtgactccaacctcacaacctgtgcgaaagtctacc
tttgatgcagccagtttcattggaggaattgtcctggtcttgggtgtgcaggctgtaatt
ttctttctttataaattctgcaaatctaaagaacgaaattaccacactctgtaa

DBGET integrated database retrieval system