KEGG   Homo sapiens (human): 8763Help
Entry
8763              CDS       T01001                                 

Gene name
CD164, DFNA66, MGC-24, MUC-24, endolyn
Definition
(RefSeq) CD164 molecule
  KO
K06546  
CD164 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    8763 (CD164)
Cellular antigens [BR:hsa04090]
 Proteins
  8763 (CD164)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 197 aa AA seqDB search
MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPET
CEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTA
NSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVI
FFLYKFCKSKERNYHTL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggctctcccgctcactgctttgggccgccacctgcctgggcgtgctctgcgtg
ctgtccgcggacaagaacacgacccagcacccgaacgtgacgactttagcgcccatctcc
aacgtaacctcggcgccggtgacgtccctcccgctggtcaccactccggcaccagaaacc
tgtgaaggtcgaaacagctgcgtttcctgttttaatgttagcgttgttaatactacctgc
ttttggatagaatgtaaagatgagagctattgttcacataactcaacagttagtgattgt
caagtggggaacacgacagacttctgttccgtttccacggccactccagtgccaacagcc
aattctacagctaaacccacagttcagccctccccttctacaacttccaagacagttact
acatcaggtacaacaaataacactgtgactccaacctcacaacctgtgcgaaagtctacc
tttgatgcagccagtttcattggaggaattgtcctggtcttgggtgtgcaggctgtaatt
ttctttctttataaattctgcaaatctaaagaacgaaattaccacactctgtaa

DBGET integrated database retrieval system