KEGG   Homo sapiens (human): 8764Help
Entry
8764              CDS       T01001                                 

Gene name
TNFRSF14, ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
Definition
tumor necrosis factor receptor superfamily, member 14
Orthology
K05152  
tumor necrosis factor receptor superfamily member 14
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8764 (TNFRSF14)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    8764 (TNFRSF14)
Cellular antigens [BR:hsa04090]
 Proteins
  8764 (TNFRSF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.32
AA seq 283 aa AA seqDB search
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcctggagactgggggcctcctccctggagatccacccccaaaaccgacgtc
ttgaggctggtgctgtatctcaccttcctgggagccccctgctacgccccagctctgccg
tcctgcaaggaggacgagtacccagtgggctccgagtgctgccccaagtgcagtccaggt
tatcgtgtgaaggaggcctgcggggagctgacgggcacagtgtgtgaaccctgccctcca
ggcacctacattgcccacctcaatggcctaagcaagtgtctgcagtgccaaatgtgtgac
ccagccatgggcctgcgcgcgagccggaactgctccaggacagagaacgccgtgtgtggc
tgcagcccaggccacttctgcatcgtccaggacggggaccactgcgccgcgtgccgcgct
tacgccacctccagcccgggccagagggtgcagaagggaggcaccgagagtcaggacacc
ctgtgtcagaactgccccccggggaccttctctcccaatgggaccctggaggaatgtcag
caccagaccaagtgcagctggctggtgacgaaggccggagctgggaccagcagctcccac
tgggtatggtggtttctctcagggagcctcgtcatcgtcattgtttgctccacagttggc
ctaatcatatgtgtgaaaagaagaaagccaaggggtgatgtagtcaaggtgatcgtctcc
gtccagcggaaaagacaggaggcagaaggtgaggccacagtcattgaggccctgcaggcc
cctccggacgtcaccacggtggccgtggaggagacaataccctcattcacggggaggagc
ccaaaccactga

DBGET integrated database retrieval system