KEGG   Homo sapiens (human): 8767Help
Entry
8767              CDS       T01001                                 

Gene name
RIPK2, CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
Definition
receptor-interacting serine-threonine kinase 2 (EC:2.7.11.1 2.7.10.2)
Orthology
K08846  
receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Neurotrophin signaling pathway
Shigellosis
Tuberculosis
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21
AA seq 540 aa AA seqDB search
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggaggccatctgcagcgccctgcccaccattccctaccacaaactcgccgac
ctgcgctacctgagccgcggcgcctctggcactgtgtcgtccgcccgccacgcagactgg
cgcgtccaggtggccgtgaagcacctgcacatccacactccgctgctcgacagtgaaaga
aaggatgtcttaagagaagctgaaattttacacaaagctagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggaatagttactgaatacatgccaaat
ggatcattaaatgaactcctacataggaaaactgaatatcctgatgttgcttggccattg
agatttcgcatcctgcatgaaattgcccttggtgtaaattacctgcacaatatgactcct
cctttacttcatcatgacttgaagactcagaatatcttattggacaatgaatttcatgtt
aagattgcagattttggtttatcaaagtggcgcatgatgtccctctcacagtcacgaagt
agcaaatctgcaccagaaggagggacaattatctatatgccacctgaaaactatgaacct
ggacaaaaatcaagggccagtatcaagcacgatatatatagctatgcagttatcacatgg
gaagtgttatccagaaaacagccttttgaagatgtcaccaatcctttgcagataatgtat
agtgtgtcacaaggacatcgacctgttattaatgaagaaagtttgccatatgatatacct
caccgagcacgtatgatctctctaatagaaagtggatgggcacaaaatccagatgaaaga
ccatctttcttaaaatgtttaatagaacttgaaccagttttgagaacatttgaagagata
acttttcttgaagctgttattcagctaaagaaaacaaagttacagagtgtttcaagtgcc
attcacctatgtgacaagaagaaaatggaattatctctgaacatacctgtaaatcatggt
ccacaagaggaatcatgtggatcctctcagctccatgaaaatagtggttctcctgaaact
tcaaggtccctgccagctcctcaagacaatgattttttatctagaaaagctcaagactgt
tattttatgaagctgcatcactgtcctggaaatcacagttgggatagcaccatttctgga
tctcaaagggctgcattctgtgatcacaagaccactccatgctcttcagcaataataaat
ccactctcaactgcaggaaactcagaacgtctgcagcctggtatagcccagcagtggatc
cagagcaaaagggaagacattgtgaaccaaatgacagaagcctgccttaaccagtcgcta
gatgcccttctgtccagggacttgatcatgaaagaggactatgaacttgttagtaccaag
cctacaaggacctcaaaagtcagacaattactagacactactgacatccaaggagaagaa
tttgccaaagttatagtacaaaaattgaaagataacaaacaaatgggtcttcagccttac
ccggaaatacttgtggtttctagatcaccatctttaaatttacttcaaaataaaagcatg
taa

DBGET integrated database retrieval system