KEGG   Homo sapiens (human): 8771Help
Entry
8771              CDS       T01001                                 

Gene name
TNFRSF6B, DCR3, DJ583P15.1.1, M68, M68E, TR6
Definition
tumor necrosis factor receptor superfamily, member 6b, decoy
Orthology
K05143  
tumor necrosis factor receptor superfamily member 6B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Disease
H00108  
Autoimmune lymphoproliferative syndromes (ALPS)
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.3
AA seq 300 aa AA seqDB search
MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQR
PCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFF
AHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLA
LNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPE
GWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgctggaggggccaggcctgtcgctgctgtgcctggtgttggcgctgcctgcc
ctgctgccggtgccggctgtacgcggagtggcagaaacacccacctacccctggcgggac
gcagagacaggggagcggctggtgtgcgcccagtgccccccaggcacctttgtgcagcgg
ccgtgccgccgagacagccccacgacgtgtggcccgtgtccaccgcgccactacacgcag
ttctggaactacctagagcgctgccgctactgcaacgtcctctgcggggagcgtgaggag
gaggcacgggcttgccacgccacccacaaccgtgcctgccgctgccgcaccggcttcttc
gcgcacgctggtttctgcttggagcacgcatcgtgtccacctggtgccggcgtgattgcc
ccgggcacccccagccagaacacgcagtgccagccgtgccccccaggcaccttctcagcc
agcagctccagctcagagcagtgccagccccaccgcaactgcacggccctgggcctggcc
ctcaatgtgccaggctcttcctcccatgacaccctgtgcaccagctgcactggcttcccc
ctcagcaccagggtaccaggagctgaggagtgtgagcgtgccgtcatcgactttgtggct
ttccaggacatctccatcaagaggctgcagcggctgctgcaggccctcgaggccccggag
ggctggggtccgacaccaagggcgggccgcgcggccttgcagctgaagctgcgtcggcgg
ctcacggagctcctgggggcgcaggacggggcgctgctggtgcggctgctgcaggcgctg
cgcgtggccaggatgcccgggctggagcggagcgtccgtgagcgcttcctccctgtgcac
tga

DBGET integrated database retrieval system