KEGG   Homo sapiens (human): 8772Help
Entry
8772              CDS       T01001                                 

Gene name
FADD, GIG3, MORT1
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  
FAS-associated death domain protein
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Apoptosis
Apoptosis - multiple species
Necroptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Alzheimer's disease
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis B
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    8772 (FADD)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8772 (FADD)
   04215 Apoptosis - multiple species
    8772 (FADD)
   04217 Necroptosis
    8772 (FADD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    8772 (FADD)
   04621 NOD-like receptor signaling pathway
    8772 (FADD)
   04622 RIG-I-like receptor signaling pathway
    8772 (FADD)
   04657 IL-17 signaling pathway
    8772 (FADD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8772 (FADD)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    8772 (FADD)
  Infectious diseases
   05152 Tuberculosis
    8772 (FADD)
   05161 Hepatitis B
    8772 (FADD)
   05168 Herpes simplex infection
    8772 (FADD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    8772 (FADD)
   05165 Human papillomavirus infection
    8772 (FADD)
   05142 Chagas disease (American trypanosomiasis)
    8772 (FADD)
  Drug resistance
   01524 Platinum drug resistance
    8772 (FADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13158(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 208 aa AA seqDB search
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagcgagctg
accgagctcaagttcctatgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcag
agcggcctagacctcttctccatgctgctggagcagaacgacctggagcccgggcacacc
gagctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcgtcgac
gacttcgaggcgggggcggcggccggggccgcgcctggggaagaagacctgtgtgcagca
tttaacgtcatatgtgataatgtggggaaagattggagaaggctggctcgtcagctcaaa
gtctcagacaccaagatcgacagcatcgaggacagatacccccgcaacctgacagagcgt
gtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacagtggcccac
ctggtgggggctctcaggtcctgccagatgaacctggtggctgacctggtacaagaggtt
cagcaggcccgtgacctccagaacaggagtggggccatgtccccgatgtcatggaactca
gacgcatctacctccgaagcgtcctga

DBGET integrated database retrieval system