KEGG   Homo sapiens (human): 8772Help
Entry
8772              CDS       T01001                                 

Gene name
FADD, MORT1
Definition
Fas (TNFRSF6)-associated via death domain
Orthology
K02373  
FAS-associated death domain protein
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
TNF signaling pathway
Alzheimer's disease
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis B
Herpes simplex infection
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    8772 (FADD)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8772 (FADD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    8772 (FADD)
   04622 RIG-I-like receptor signaling pathway
    8772 (FADD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8772 (FADD)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    8772 (FADD)
  Infectious diseases
   05152 Tuberculosis
    8772 (FADD)
   05161 Hepatitis B
    8772 (FADD)
   05168 Herpes simplex infection
    8772 (FADD)
   05142 Chagas disease (American trypanosomiasis)
    8772 (FADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 208 aa AA seqDB search
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagcgagctg
accgagctcaagttcctatgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcag
agcggcctagacctcttctccatgctgctggagcagaacgacctggagcccgggcacacc
gagctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcgtcgac
gacttcgaggcgggggcggcggccggggccgcgcctggggaagaagacctgtgtgcagca
tttaacgtcatatgtgataatgtggggaaagattggagaaggctggctcgtcagctcaaa
gtctcagacaccaagatcgacagcatcgaggacagatacccccgcaacctgacagagcgt
gtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacagtggcccac
ctggtgggggctctcaggtcctgccagatgaacctggtggctgacctggtacaagaggtt
cagcaggcccgtgacctccagaacaggagtggggccatgtccccgatgtcatggaactca
gacgcatctacctccgaagcgtcctga

DBGET integrated database retrieval system