KEGG   Homo sapiens (human): 8772Help
Entry
8772              CDS       T01001                                 

Gene name
FADD, MORT1
Definition
Fas (TNFRSF6)-associated via death domain
Orthology
K02373  
FAS-associated death domain protein
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
TNF signaling pathway
Alzheimer's disease
Chagas disease (American trypanosomiasis)
Tuberculosis
Hepatitis B
Herpes simplex infection
Pathways in cancer
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 208 aa AA seqDB search
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagcgagctg
accgagctcaagttcctatgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcag
agcggcctagacctcttctccatgctgctggagcagaacgacctggagcccgggcacacc
gagctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcgtcgac
gacttcgaggcgggggcggcggccggggccgcgcctggggaagaagacctgtgtgcagca
tttaacgtcatatgtgataatgtggggaaagattggagaaggctggctcgtcagctcaaa
gtctcagacaccaagatcgacagcatcgaggacagatacccccgcaacctgacagagcgt
gtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacagtggcccac
ctggtgggggctctcaggtcctgccagatgaacctggtggctgacctggtacaagaggtt
cagcaggcccgtgacctccagaacaggagtggggccatgtccccgatgtcatggaactca
gacgcatctacctccgaagcgtcctga

DBGET integrated database retrieval system