KEGG   Homo sapiens (human): 8773Help
Entry
8773              CDS       T01001                                 

Gene name
SNAP23, HsT17016, SNAP-23, SNAP23A, SNAP23B
Definition
synaptosomal-associated protein, 23kDa
Orthology
K08508  
synaptosomal-associated protein 23
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8773 (SNAP23)
 Organismal Systems
  Immune system
   04611 Platelet activation
    8773 (SNAP23)
SNAREs [BR:hsa04131]
 SNAP-25 (Qb,c)
  SNAP-23
   8773 (SNAP23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8773 (SNAP23)
  Exosomal proteins of other body fluids (saliva and urine)
   8773 (SNAP23)
  Exosomal proteins of colorectal cancer cells
   8773 (SNAP23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q14
AA seq 211 aa AA seqDB search
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggataatctgtcatcagaagaaattcaacagagagctcaccagattactgatgagtct
ctggaaagtacgaggagaatcctgggtttagccattgagtctcaggatgcaggaatcaag
accatcactatgctggatgaacaaaaggaacaactaaaccgcatagaagaaggcttggac
caaataaataaggacatgagagagacagagaagactttaacagaactcaacaaatgctgt
ggcctttgtgtctgcccatgtaatagaacaaagaactttgagtctggcaaggcttataag
acaacatggggagatggtggagaaaactcaccttgcaatgtagtatctaaacagccaggc
ccggtgacaaatggtcagcttcagcaaccaacaacgggagcagccagtggtggatacatt
aaacgcataactaatgatgccagagaagatgaaatggaagagaacctgactcaagtgggc
agtatcctgggaaatctaaaagacatggccctgaacataggcaatgagattgatgctcaa
aatccacaaataaaacgaatcacagacaaggctgacaccaacagagatcgtattgatatt
gccaatgccagagcaaagaaactcattgacagctaa

DBGET integrated database retrieval system