KEGG   Homo sapiens (human): 8773Help
Entry
8773              CDS       T01001                                 

Gene name
SNAP23, HsT17016, SNAP-23, SNAP23A, SNAP23B
Definition
(RefSeq) synaptosome associated protein 23
  KO
K08508  synaptosomal-associated protein 23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8773 (SNAP23)
 Organismal Systems
  Immune system
   04611 Platelet activation
    8773 (SNAP23)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-23
    8773 (SNAP23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8773 (SNAP23)
  Exosomal proteins of other body fluids (saliva and urine)
   8773 (SNAP23)
  Exosomal proteins of colorectal cancer cells
   8773 (SNAP23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNAP-25 DUF5089 V-SNARE_C Sec20 DUF1664 Sulfatase_C
Motif
Other DBs
NCBI-GeneID: 8773
NCBI-ProteinID: NP_003816
OMIM: 602534
HGNC: 11131
Ensembl: ENSG00000092531
Vega: OTTHUMG00000130625
Pharos: O00161(Tbio)
UniProt: O00161 A8K287
Structure
PDB: 

Jmol
Position
15q15.1-q15.2
AA seq 211 aa AA seqDB search
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggataatctgtcatcagaagaaattcaacagagagctcaccagattactgatgagtct
ctggaaagtacgaggagaatcctgggtttagccattgagtctcaggatgcaggaatcaag
accatcactatgctggatgaacaaaaggaacaactaaaccgcatagaagaaggcttggac
caaataaataaggacatgagagagacagagaagactttaacagaactcaacaaatgctgt
ggcctttgtgtctgcccatgtaatagaacaaagaactttgagtctggcaaggcttataag
acaacatggggagatggtggagaaaactcaccttgcaatgtagtatctaaacagccaggc
ccggtgacaaatggtcagcttcagcaaccaacaacgggagcagccagtggtggatacatt
aaacgcataactaatgatgccagagaagatgaaatggaagagaacctgactcaagtgggc
agtatcctgggaaatctaaaagacatggccctgaacataggcaatgagattgatgctcaa
aatccacaaataaaacgaatcacagacaaggctgacaccaacagagatcgtattgatatt
gccaatgccagagcaaagaaactcattgacagctaa

DBGET integrated database retrieval system