KEGG   Homo sapiens (human): 8775Help
Entry
8775              CDS       T01001                                 

Gene name
NAPA, SNAPA
Definition
N-ethylmaleimide-sensitive factor attachment protein, alpha
Orthology
K15296  
alpha-soluble NSF attachment protein
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    8775 (NAPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 295 aa AA seqDB search
MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK
AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacaattccgggaaggaagcggaggcgatggcgctgttggccgaggcggagcgcaaa
gtgaagaactcgcagtccttcttctctggcctctttggaggctcatccaaaatagaggaa
gcatgcgaaatctacgccagagcagcaaacatgttcaaaatggccaaaaactggagtgct
gctggaaacgcgttctgccaggctgcacagctgcacctgcagctccagagcaagcacgac
gcagccacctgctttgtggacgctggcaacgcattcaagaaagccgacccccaagaggcc
attaactgtttgatgcgagcaatcgagatctacacagacatgggccgattcacgattgcg
gccaagcaccacatctccattgctgagatctatgagacagagttggtggacatcgagaag
gccattgcccactacgagcagtctgcagactactacaaaggcgaggagtccaacagctca
gccaacaagtgtctgctgaaggtggctggttacgctgcgctgctggagcagtatcagaag
gccattgacatctacgaacaggtggggaccaatgccatggacagccccctcctcaagtac
agcgccaaagactacttcttcaaggcggccctctgccacttctgcatcgacatgctcaac
gccaagctggctgtccaaaagtatgaggagctgttcccagctttctctgattcccgggaa
tgcaagttgatgaaaaaattgctagaggcccacgaggagcagaatgtggacagctacacc
gagtcggtgaaggaatacgactccatctcccggctggaccagtggctcaccaccatgctg
ctgcgcatcaagaagaccatccagggcgatgaggaggacctgcgctaa

DBGET integrated database retrieval system