KEGG   Homo sapiens (human): 8778Help
Entry
8778              CDS       T01001                                 

Gene name
SIGLEC5, CD170, CD33L2, OB-BP2, OBBP2, SIGLEC-5
Definition
(RefSeq) sialic acid binding Ig like lectin 5
  KO
K06549  sialic acid binding Ig-like lectin 5/14
Organism
hsa  Homo sapiens (human)
Brite
CD molecules [BR:hsa04090]
 Proteins
  8778 (SIGLEC5)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  8778 (SIGLEC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_2 Ig_3 ig I-set C2-set_2
Motif
Other DBs
NCBI-GeneID: 8778
NCBI-ProteinID: NP_003821
OMIM: 604200
HGNC: 10874
Ensembl: ENSG00000105501
Vega: OTTHUMG00000165510
Pharos: O15389(Tbio)
UniProt: O15389
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 551 aa AA seqDB search
MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYW
FRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRV
ERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSW
TGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQMKRQGAQVTTERTVQLNVSYAPQTIT
IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILE
LRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPA
PSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQS
GSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVKARRKQAAGRPEKMDDED
PIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPS
TTEYSEIKTSK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccctgctgctgctgcccctgctgtggggggggtccctgcaggagaagccagtg
tacgagctgcaagtgcagaagtcggtgacggtgcaggagggcctgtgcgtccttgtgccc
tgctccttctcttacccctggagatcctggtattcctctcccccactctacgtctactgg
ttccgggacggggagatcccatactacgctgaggttgtggccacaaacaacccagacaga
agagtgaagccagagacccagggccgattccgcctccttggggatgtccagaagaagaac
tgctccctgagcatcggagatgccagaatggaggacacgggaagctatttcttccgcgtg
gagagaggaagggatgtaaaatatagctaccaacagaataagctgaacttggaggtgaca
gccctgatagagaaacccgacatccactttctggagcctctggagtccggccgccccaca
aggctgagctgcagccttccaggatcctgtgaagcgggaccacctctcacattctcctgg
acggggaatgccctcagccccctggaccccgagaccacccgctcctcggagctcaccctc
acccccaggcccgaggaccatggcaccaacctcacctgtcagatgaaacgccaaggagct
caggtgaccacggagagaactgtccagctcaatgtctcctatgctccacagaccatcacc
atcttcaggaacggcatagccctagagatcctgcaaaacacctcataccttccggtcctg
gagggccaggctctgcggctgctctgtgatgctcccagcaacccccctgcacacctgagc
tggttccagggctcccctgccctgaacgccacccccatctccaataccgggatcttggag
cttcgtcgagtaaggtctgcagaagaaggaggcttcacctgccgcgctcagcacccgctg
ggcttcctgcaaatttttctgaatctctcagtttactccctcccacagttgctgggcccc
tcctgctcctgggaggctgagggtctgcactgcagatgctcctttcgagcccggccggcc
ccctccctgtgctggcggcttgaggagaagccgctggaggggaacagcagccagggctca
ttcaaggtcaactccagctcagctgggccctgggccaacagctccctgatcctccacggg
gggctcagctccgacctcaaagtcagctgcaaggcctggaacatctatgggtcccagagc
ggctctgtcctgctgctgcaagggagatcgaacctcgggacaggagtggttcctgcagcc
cttggtggtgctggtgtcatggccctgctctgtatctgtctgtgcctcatcttcttttta
atagtgaaagcccgcaggaagcaagcagctgggagaccagagaaaatggatgatgaagac
cccattatgggtaccatcacctcgggttccaggaagaagccctggccagacagccccgga
gatcaagcatctcctcctggggatgcccctcccttggaagaacaaaaggagctccattat
gcctcccttagtttttctgagatgaagtcgagggagcctaaggaccaggaggccccaagc
accacggagtactcggagatcaagacaagcaagtga

DBGET integrated database retrieval system