KEGG   Homo sapiens (human): 8778Help
Entry
8778              CDS       T01001                                 

Gene name
SIGLEC5, CD170, CD33L2, OB-BP2, OBBP2, SIGLEC-5
Definition
sialic acid binding Ig-like lectin 5
Orthology
K06549  
sialic acid binding Ig-like lectin 5/14
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 551 aa AA seqDB search
MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYW
FRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRV
ERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSW
TGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQMKRQGAQVTTERTVQLNVSYAPQTIT
IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILE
LRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPA
PSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQS
GSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVKARRKQAAGRPEKMDDED
PIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPS
TTEYSEIKTSK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccctgctgctgctgcccctgctgtggggggggtccctgcaggagaagccagtg
tacgagctgcaagtgcagaagtcggtgacggtgcaggagggcctgtgcgtccttgtgccc
tgctccttctcttacccctggagatcctggtattcctctcccccactctacgtctactgg
ttccgggacggggagatcccatactacgctgaggttgtggccacaaacaacccagacaga
agagtgaagccagagacccagggccgattccgcctccttggggatgtccagaagaagaac
tgctccctgagcatcggagatgccagaatggaggacacgggaagctatttcttccgcgtg
gagagaggaagggatgtaaaatatagctaccaacagaataagctgaacttggaggtgaca
gccctgatagagaaacccgacatccactttctggagcctctggagtccggccgccccaca
aggctgagctgcagccttccaggatcctgtgaagcgggaccacctctcacattctcctgg
acggggaatgccctcagccccctggaccccgagaccacccgctcctcggagctcaccctc
acccccaggcccgaggaccatggcaccaacctcacctgtcagatgaaacgccaaggagct
caggtgaccacggagagaactgtccagctcaatgtctcctatgctccacagaccatcacc
atcttcaggaacggcatagccctagagatcctgcaaaacacctcataccttccggtcctg
gagggccaggctctgcggctgctctgtgatgctcccagcaacccccctgcacacctgagc
tggttccagggctcccctgccctgaacgccacccccatctccaataccgggatcttggag
cttcgtcgagtaaggtctgcagaagaaggaggcttcacctgccgcgctcagcacccgctg
ggcttcctgcaaatttttctgaatctctcagtttactccctcccacagttgctgggcccc
tcctgctcctgggaggctgagggtctgcactgcagatgctcctttcgagcccggccggcc
ccctccctgtgctggcggcttgaggagaagccgctggaggggaacagcagccagggctca
ttcaaggtcaactccagctcagctgggccctgggccaacagctccctgatcctccacggg
gggctcagctccgacctcaaagtcagctgcaaggcctggaacatctatgggtcccagagc
ggctctgtcctgctgctgcaagggagatcgaacctcgggacaggagtggttcctgcagcc
cttggtggtgctggtgtcatggccctgctctgtatctgtctgtgcctcatcttcttttta
atagtgaaagcccgcaggaagcaagcagctgggagaccagagaaaatggatgatgaagac
cccattatgggtaccatcacctcgggttccaggaagaagccctggccagacagccccgga
gatcaagcatctcctcctggggatgcccctcccttggaagaacaaaaggagctccattat
gcctcccttagtttttctgagatgaagtcgagggagcctaaggaccaggaggccccaagc
accacggagtactcggagatcaagacaagcaagtga

DBGET integrated database retrieval system