KEGG   Homo sapiens (human): 8784Help
Entry
8784              CDS       T01001                                 

Gene name
TNFRSF18, AITR, CD357, GITR, GITR-D
Definition
tumor necrosis factor receptor superfamily, member 18
Orthology
K05154  
tumor necrosis factor receptor superfamily member 18
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8784 (TNFRSF18)
Cellular antigens [BR:hsa04090]
 Proteins
  8784 (TNFRSF18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.3
AA seq 241 aa AA seqDB search
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF
SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL
TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcacggggcgatgggcgcgtttcgggccctgtgcggcctggcgctgctgtgc
gcgctcagcctgggtcagcgccccaccgggggtcccgggtgcggccctgggcgcctcctg
cttgggacgggaacggacgcgcgctgctgccgggttcacacgacgcgctgctgccgcgat
tacccgggcgaggagtgctgttccgagtgggactgcatgtgtgtccagcctgaattccac
tgcggagacccttgctgcacgacctgccggcaccacccttgtcccccaggccagggggta
cagtcccaggggaaattcagttttggcttccagtgtatcgactgtgcctcggggaccttc
tccgggggccacgaaggccactgcaaaccttggacagactgcacccagttcgggtttctc
actgtgttccctgggaacaagacccacaacgctgtgtgcgtcccagggtccccgccggca
gagccgcttgggtggctgaccgtcgtcctcctggccgtggccgcctgcgtcctcctcctg
acctcggcccagcttggactgcacatctggcagctgaggagtcagtgcatgtggccccga
gagacccagctgctgctggaggtgccgccgtcgaccgaagacgccagaagctgccagttc
cccgaggaagagcggggcgagcgatcggcagaggagaaggggcggctgggagacctgtgg
gtgtga

DBGET integrated database retrieval system