KEGG   Homo sapiens (human): 8786Help
Entry
8786              CDS       T01001                                 

Gene name
RGS11, RS11
Definition
(RefSeq) regulator of G-protein signaling 11
  KO
K16449  
regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 467 aa AA seqDB search
MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQW
LAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAE
LDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRL
VIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRT
RVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERW
GFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYEQFLA
PGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggccccgcgccgccccccggccgcccccgggcgcagatgccgcatctgagg
aagatggagcgggtggtcgtgagcatgcaggaccccgaccagggcgtgaagatgcggagc
cagcgcctgctggtcaccgtcattccccacgcggtgacaggcagcgacgtcgtgcagtgg
ttggcccagaagttctgcgtctcggaggaggaggccctgcacctgggcgccgtcctggtg
cagcatggctacatctacccgctgcgcgacccccgtagcctcatgctccggccagacgag
acgccctacaggttccagaccccgtacttctggacaagtaccctgaggccggctgcagag
ctggactatgccatctacctggccaagaagaacatccgaaaacgggggaccctggtggat
tatgagaaggactgctatgaccggctacacaagaagatcaaccacgcatgggacctggtg
ctgatgcaggcgagggagcagctgagggcagccaagcagcgcagcaagggggacaggctg
gtcattgcgtgccaggagcagacctactggctggtgaacaggcccccgcccggggccccc
gatgtgctggagcagggtccagggcggggatcctgcgctgccagccgtgtgctcatgacc
aagagtgcagatttccataagcgggagatcgagtacttcaggaaagcgctgggcaggacc
cgagtgaagtcctccgtctgccttgaggcgtacctgagtttctgcggccagcgtggaccc
cacgatcccctcgtgtcggggtgcctgcccagcaatccctggatctcagacaatgacgcc
tactgggtcatgaatgcccccacggtggctgcccccacgaagctccgtgtggagagatgg
ggcttcagcttccgggagctcctggaggaccccgtggggcgggcccacttcatggacttt
ctgggaaaggagttcagtggagaaaacctcagcttctgggaggcatgtgaggagcttcga
tatggagcgcaggcccaggtccccaccctggtggatgccgtgtacgagcagttcctggcc
cccggagctgcccactgggtcaacatcgacagccggaccatggagcagaccctggagggg
ctgcgccagccccaccgctatgtcctggatgacgcccagctgcacatatacatgctcatg
aagaaggactcctacccaaggttcctgaagtctgacatgtacaaggccctcctggcagag
gctgggatcccgctggagatgaagagacgcgtgttcccgtttacgtggaggccacggcac
tcgagccccagccctgcactccttcccacccctgtggagcccacagcggcttgtggccct
gggggtggagatggggtggcctag

DBGET integrated database retrieval system