KEGG   Homo sapiens (human): 8787Help
Entry
8787              CDS       T01001                                 

Gene name
RGS9, PERRS, RGS9L
Definition
regulator of G-protein signaling 9
Orthology
K13765  
regulator of G-protein signaling 9
Organism
hsa  Homo sapiens (human)
Pathway
Phototransduction
Cocaine addiction
Disease
H00973  
Bradyopsia
Class
Organismal Systems; Sensory system; Phototransduction [PATH:hsa04744]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24
AA seq 671 aa AA seqDB search
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIV
QRLWISSLEAQNLGNFIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYAL
DCQEKAYWLVHRCPPGMDNVLDYGLDRVTNPNEVKKQTVVAVKKEIMYYQQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNF
SELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGAR
RWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKAIEP
QETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHLTVY
TGTCMPPSPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKGECS
GSMAPRGPSVTESSEASLDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLSPKC
PAVSHGRVQPLGDVGQQLPRLKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRAT
EKEVICPWESL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccgacaccaaggccagcagtacaggccgaggatggcatttctccaaaagatt
gaagcgctcgtgaaggacatgcagaacccagagacaggggtccgaatgcagaaccagagg
gtcctggtcaccagcgttcctcatgccatgacaggaagtgatgttctgcaatggatcgtc
cagcggctttggatctccagtctggaggcacagaacttgggcaactttattgtcaggtat
ggctacatttaccccctgcaagaccccaagaatctcattctcaagcctgatggcagcctc
tacagatttcagacaccgtatttctggcccacccagcagtggccagctgaagataccgat
tacgccatctatctggccaagcgaaatatcaaaaagaaagggattttggaagaatatgaa
aaggaaaattacaatttcttgaaccaaaaaatgaactataagtgggactttgtcattatg
caggccaaagagcagtacagggctggaaaggagaggaacaaagcagacagatatgccctg
gactgccaggagaaggcatactggctggtgcaccgatgccctcctggaatggacaatgtg
ctggactacggcctggaccgagtgaccaatccgaatgaagtcaagaaacaaacagtcgtt
gctgtcaaaaaagagatcatgtattaccaacaggccttgatgaggtccacagtgaagtct
tctgtgtccctgggagggattgtgaaatacagtgagcagttctcatccaacgatgccatc
atgtcaggctgcctccccagcaacccctggatcaccgatgacacccagttctgggactta
aatgccaaattggtggaaatcccaaccaagatgcgagtggaacgatgggccttcaacttc
agcgaattgatccgagaccccaaaggtcgacagagcttccagtacttcctcaagaaagaa
ttcagtggagagaatctgggattctgggaagcctgcgaggatctgaagtatggagatcag
tccaaagtcaaggagaaagcagaggagatttacaagctgttcctggccccgggggcgagg
cgctggatcaacatagatggcaaaaccatggacatcacagtgaaggggctgaagcacccc
caccgctatgtgctggacgccgcacaaacccacatttacatgctcatgaagaaggattct
tatgctcgctatttaaaatctccgatctataaggacatgctggccaaagctattgaacct
caggaaaccaccaagaaaagctccaccctcccttttatgcggcgtcacctgcgctccagc
ccaagccctgtcatcctgagacagctggaagaggaagccaaggcccgagaagcagccaac
actgtggacatcacccagccgggccagcacatggctcccagcccccatctgaccgtgtac
accgggacctgcatgcccccgtctccttctagccccttctcctcctcctgccgctccccc
aggaagcctttcgcctcacccagccgcttcatccggcgacccagcaccaccatctgcccc
tcacccatcagagtggccttggagagctcatcgggcttggagcagaaaggggagtgcagc
gggtccatggccccccgtgggccctctgtcaccgagagcagcgaggcctccctcgacacc
tcctggcctcgcagccggcccagggcccctcctaaggcccgcatggctctgtccttcagc
aggtttctgagacgaggctgtctggcctcacctgtctttgccaggctctcacccaagtgc
cctgctgtgtcccacgggagggtgcagcccctgggggacgtgggccagcagctgccacga
ttgaaatccaagagagtagcaaactttttccagatcaaaatggatgtgcccacggggagc
gggacctgcttgatggactcggaggatgctggaacaggagagtcgggtgaccgggccaca
gaaaaggaggtcatctgcccctgggagagcctgtaa

DBGET integrated database retrieval system