KEGG   Homo sapiens (human): 8790Help
Entry
8790              CDS       T01001                                 

Gene name
FPGT, GFPP
Definition
(RefSeq) fucose-1-phosphate guanylyltransferase (EC:2.7.7.30)
  KO
K00976  
fucose-1-phosphate guanylyltransferase [EC:2.7.7.30]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    8790 (FPGT)
   00520 Amino sugar and nucleotide sugar metabolism
    8790 (FPGT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.30  fucose-1-phosphate guanylyltransferase
     8790 (FPGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p31.1
AA seq 607 aa AA seqDB search
MRAVRRGLREGGAMAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADE
KQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSF
TILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCA
DDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRF
LHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAF
YEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLN
VVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSIL
DSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYA
TMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARI
FPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEI
SLKSSLM
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgtgcggcgcggtctcagggaaggtggggctatggcagctgctagggaccct
ccggaagtatcgctgcgagaagccacccagcgaaaattgcggaggttttccgagctaaga
ggcaaacttgtagcacgtggagaattctgggacatagttgcaataacagcggctgatgaa
aaacaggaacttgcttacaaccaacagctgtcagaaaagctgaaaagaaaggagttaccc
cttggagttcaatatcacgtttttgtggatcctgctggagccaaaattggaaatggagga
tcaacactttgtgcccttcaatgtttggaaaagctatatggagataaatggaattctttt
accatcttattaattcactctggtggctacagtcaacgacttccaaatgcaagtgctctg
ggaaaaattttcactgctttacctcttggtaaccccatttatcagatgctagaattaaaa
ctagccatgtacattgatttccccttaaatatgaatcctggaattctggttacctgtgca
gatgatattgaactttatagtattggagaatttgagtttattaggtttgacaaacctggc
tttactgctttagctcatccttctagtttgacgataggtaccacacatggagtatttgtc
ttagatccttttgatgatttaaaacatagagaccttgaatacaggtcttgccatcgtttc
cttcataagcccagcatagaaaagatgtatcagtttaatgctgtgtgtagacctggaaat
ttttgtcaacaggactttgctgggggtgacattgccgatcttaaattagactctgactat
gtctacacagatagcctattttatatggatcataaatcagcaaaaatgttacttgctttt
tatgaaaaaataggcacactgagctgtgaaatagatgcctatggtgactttctgcaggct
ttgggacctggagcaactgtggagtacaccagaaacacatcaaatgtcattaaagaagag
tcagagttggtagaaatgaggcagagaatatttcatcttcttaaaggaacatcactaaat
gttgttgttcttaataactccaaattttatcacattggaacaaccgaagaatatttgttt
tactttacctcagataacagtttaaagtcagagctcggcttacagtccataacttttagt
atctttccagatataccagaatgctctggcaaaacatcctgtatcattcaaagcatactg
gattcaagatgttctgtggcacctggctcagttgtggagtattccagattggggcctgat
gtttcagttggggaaaactgcattattagtggttcttacatcctaacaaaagctgccctc
cccgcacattcttttgtatgttccttaagcttaaagatgaatagatgcttaaagtatgca
actatggcatttggagtgcaagacaacttgaaaaagagtgtgaaaacattgtcagatata
aagttacttcaattctttggagtctgtttcctgtcatgcttagatgtttggaatcttaaa
gttacagaggaactgttctctggtaacaagacatgtctgagtttgtggactgcacgcatt
ttcccagtttgttcttctttgagtgactcagttataacatccctaaagatgttaaatgct
gttaagaacaagtcagcattcagcctgaatagctataagttgctgtccattgaagaaatg
cttatctacaaagatgtagaagatatgataacttacagggaacaaatttttctagaaatc
agtttaaaaagcagtttgatgtag

DBGET integrated database retrieval system