KEGG   Homo sapiens (human): 8792Help
Entry
8792              CDS       T01001                                 

Gene name
TNFRSF11A, CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCER
Definition
tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Orthology
K05147  
tumor necrosis factor receptor superfamily member 11A
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Osteoclast differentiation
Prolactin signaling pathway
Rheumatoid arthritis
Disease
H00436  
Osteopetrosis
H00437  
Paget's disease of bone and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8792 (TNFRSF11A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8792 (TNFRSF11A)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    8792 (TNFRSF11A)
  Development
   04380 Osteoclast differentiation
    8792 (TNFRSF11A)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    8792 (TNFRSF11A)
Cellular antigens [BR:hsa04090]
 Proteins
  8792 (TNFRSF11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q22.1
AA seq 263 aa AA seqDB search
MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKC
TTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHW
SQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGK
RVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGK
ALTANLWHWINEACGRLSGDKEM
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcgcccggcggcgccgcccgctgttcgcgctgctgctgctctgcgcgctg
ctcgcccggctgcaggtggctttgcagatcgctcctccatgtaccagtgagaagcattat
gagcatctgggacggtgctgtaacaaatgtgaaccaggaaagtacatgtcttctaaatgc
actactacctctgacagtgtatgtctgccctgtggcccggatgaatacttggatagctgg
aatgaagaagataaatgcttgctgcataaagtttgtgatacaggcaaggccctggtggcc
gtggtcgccggcaacagcacgaccccccggcgctgcgcgtgcacggctgggtaccactgg
agccaggactgcgagtgctgccgccgcaacaccgagtgcgcgccgggcctgggcgcccag
cacccgttgcagctcaacaaggacacagtgtgcaaaccttgccttgcaggctacttctct
gatgccttttcctccacggacaaatgcagaccctggaccaactgtaccttccttggaaag
agagtagaacatcatgggacagagaaatccgatgcggtttgcagttcttctctgccagct
agaaaaccaccaaatgaaccccatgtttacttgcccggtttaataattctgcttctcttc
gcgtctgtggccctggtggctgccatcatctttggcgtttgctataggaaaaaagggaaa
gcactcacagctaatttgtggcactggatcaatgaggcttgtggccgcctaagtggagat
aaggaaatgtga

DBGET integrated database retrieval system