KEGG   Homo sapiens (human): 8792Help
Entry
8792              CDS       T01001                                 

Gene name
TNFRSF11A, CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCER
Definition
(RefSeq) TNF receptor superfamily member 11a
  KO
K05147  tumor necrosis factor receptor superfamily member 11A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04917  Prolactin signaling pathway
hsa05323  Rheumatoid arthritis
Disease
H00436  Osteopetrosis
H00437  Paget's disease of bone
H02042  Familial expansile osteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8792 (TNFRSF11A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8792 (TNFRSF11A)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    8792 (TNFRSF11A)
  Development
   04380 Osteoclast differentiation
    8792 (TNFRSF11A)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    8792 (TNFRSF11A)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8792 (TNFRSF11A)
CD molecules [BR:hsa04090]
 Proteins
  8792 (TNFRSF11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 DAG1 KIX Abi
Motif
Other DBs
NCBI-GeneID: 8792
NCBI-ProteinID: NP_003830
OMIM: 603499
HGNC: 11908
Ensembl: ENSG00000141655
Vega: OTTHUMG00000132779
Pharos: Q9Y6Q6(Tbio)
UniProt: Q9Y6Q6
Position
18q21.33
AA seq 616 aa AA seqDB search
MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKC
TTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHW
SQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGK
RVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGK
ALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMC
YPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQL
LFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSEN
YLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPP
EEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVM
NFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLRE
PEKASRPVQEQGGAKA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcgcccggcggcgccgcccgctgttcgcgctgctgctgctctgcgcgctg
ctcgcccggctgcaggtggctttgcagatcgctcctccatgtaccagtgagaagcattat
gagcatctgggacggtgctgtaacaaatgtgaaccaggaaagtacatgtcttctaaatgc
actactacctctgacagtgtatgtctgccctgtggcccggatgaatacttggatagctgg
aatgaagaagataaatgcttgctgcataaagtttgtgatacaggcaaggccctggtggcc
gtggtcgccggcaacagcacgaccccccggcgctgcgcgtgcacggctgggtaccactgg
agccaggactgcgagtgctgccgccgcaacaccgagtgcgcgccgggcctgggcgcccag
cacccgttgcagctcaacaaggacacagtgtgcaaaccttgccttgcaggctacttctct
gatgccttttcctccacggacaaatgcagaccctggaccaactgtaccttccttggaaag
agagtagaacatcatgggacagagaaatccgatgcggtttgcagttcttctctgccagct
agaaaaccaccaaatgaaccccatgtttacttgcccggtttaataattctgcttctcttc
gcgtctgtggccctggtggctgccatcatctttggcgtttgctataggaaaaaagggaaa
gcactcacagctaatttgtggcactggatcaatgaggcttgtggccgcctaagtggagat
aaggagtcctcaggtgacagttgtgtcagtacacacacggcaaactttggtcagcaggga
gcatgtgaaggtgtcttactgctgactctggaggagaagacatttccagaagatatgtgc
tacccagatcaaggtggtgtctgtcagggcacatgtgtaggaggtggtccctacgcacaa
ggcgaagatgccaggatgctctcattggtcagcaagaccgagatagaggaagacagcttc
agacagatgcccacagaagatgaatacatggacaggccctcccagcccacagaccagtta
ctgttcctcactgagcctggaagcaaatccacacctcctttctctgaacccctggaggtg
ggggagaatgacagtttaagccagtgcttcacggggacacagagcacagtgggttcagaa
agctgcaactgcactgagcccctgtgcaggactgattggactcccatgtcctctgaaaac
tacttgcaaaaagaggtggacagtggccattgcccgcactgggcagccagccccagcccc
aactgggcagatgtctgcacaggctgccggaaccctcctggggaggactgtgaacccctc
gtgggttccccaaaacgtggacccttgccccagtgcgcctatggcatgggccttccccct
gaagaagaagccagcaggacggaggccagagaccagcccgaggatggggctgatgggagg
ctcccaagctcagcgagggcaggtgccgggtctggaagctcccctggtggccagtcccct
gcatctggaaatgtgactggaaacagtaactccacgttcatctccagcgggcaggtgatg
aacttcaagggcgacatcatcgtggtctacgtcagccagacctcgcaggagggcgcggcg
gcggctgcggagcccatgggccgcccggtgcaggaggagaccctggcgcgccgagactcc
ttcgcggggaacggcccgcgcttcccggacccgtgcggcggccccgaggggctgcgggag
ccggagaaggcctcgaggccggtgcaggagcaaggcggggccaaggcttga

DBGET integrated database retrieval system