KEGG   Homo sapiens (human): 8798Help
Entry
8798              CDS       T01001                                 

Gene name
DYRK4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     8798 (DYRK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   8798 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.32
AA seq 234 aa AA seqDB search
MWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKN
ITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNL
KPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQ
QDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcctgggctgcatcacggcggagttgtacacgggctaccccctgttccccggg
gagaatgaggtggagcagctggcctgcatcatggaggtgctgggtctgccgccagccggc
ttcattcagacagcctccaggagacagacattctttgattccaaaggttttcctaaaaat
ataaccaacaacagggggaaaaaaagatacccagattccaaggacctcacgatggtgctg
aaaacctatgacaccagcttcctggactttctcagaaggtgtttggtatgggaaccttct
cttcgcatgaccccggaccaggccctcaagcatgcttggattcatcagtctcggaacctc
aagccacagcccaggccccagaccctgaggaaatccaattcctttttcccctctgagaca
aggaaggacaaggttcaaggctgtcatcactcgagcagaaaagcagatgagatcaccaaa
gagactacagagaaaacaaaagatagccccacgaagcatgttcagcattcaggtgatcag
caggactgtctccagcacggagctgacactgttcagctgcctcaactggtagacgctccc
aagaagtcagaggcagctgtcggggcggaggtgtccatgacctccccaggacagagcaaa
aacttctccctcaagaacacaaacgttttaccccctattgtatga

DBGET integrated database retrieval system