KEGG   Homo sapiens (human): 88Help
Entry
88                CDS       T01001                                 

Gene name
ACTN2, CMD1AA
Definition
actinin, alpha 2
Orthology
K05699  
actinin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Amoebiasis
Viral carcinogenesis
Systemic lupus erythematosus
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H00294  
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    88 (ACTN2)
  Cell communication
   04510 Focal adhesion
    88 (ACTN2)
   04520 Adherens junction
    88 (ACTN2)
   04530 Tight junction
    88 (ACTN2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    88 (ACTN2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    88 (ACTN2)
  Immune diseases
   05322 Systemic lupus erythematosus
    88 (ACTN2)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    88 (ACTN2)
  Infectious diseases
   05146 Amoebiasis
    88 (ACTN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   88 (ACTN2)
  Exosomal proteins of colorectal cancer cells
   88 (ACTN2)
  Exosomal proteins of bladder cancer cells
   88 (ACTN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42-q43
AA seq 894 aa AA seqDB search
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatagagcccggcgtgcagtacaactacgtgtacgacgaggatgagtacatg
atccaggaggaggagtgggaccgcgacctgctcctggacccagcctgggagaagcagcag
aggaagaccttcactgcctggtgtaactcccacctaaggaaagccggcacccagattgag
aacatcgaggaagacttcaggaatggccttaagctcatgctgcttttggaagtcatctca
ggggaaaggctgcccaaacctgaccggggaaaaatgcggttccacaaaattgctaatgtc
aacaaagctttggattacatagccagcaaaggggtgaaactggtgtccatcggcgctgaa
gaaattgttgatggcaatgtgaaaatgaccctgggtatgatctggaccatcatccttcgc
tttgctattcaggatatttcggttgaagaaacatctgccaaagaaggtctgctgctttgg
tgtcagaggaaaactgctccttatagaaatgtgaacattcagaacttccatactagctgg
aaagatggccttggactctgtgccctcatccaccgacaccggcctgacctcattgactac
tcaaagcttaacaaggatgaccccataggaaatattaacctggccatggaaatcgctgag
aagcacctggatattcctaaaatgttggatgctgaagacatcgtgaacacccctaaaccc
gatgaaagagccatcatgacgtacgtctcttgcttctaccacgcttttgcgggcgcggag
caggccgagacagcggctaacaggatatgtaaggttcttgctgtgaatcaagagaatgag
aggctgatggaagaatatgagaggctagcgagtgagcttttggaatggattcgtcgcacg
atcccctggctggagaaccggactcccgagaagaccatgcaagccatgcagaagaagctg
gaggacttccgggattaccgccggaagcacaagccacccaaggtgcaggagaaatgccag
ctggagatcaacttcaacacgctgcagaccaagctgcggatcagcaaccgtcctgccttc
atgccctccgagggcaagatggtgtcggatattgctggtgcctggcagaggctggagcag
gctgagaagggttacgaggagtggttgctcaatgagattcggagactggagcgcttggaa
cacctggctgagaagttcaggcagaaggcctcaacgcacgagacttgggcttatggcaaa
gagcagatcttgctgcagaaggattacgagtcggcgtcgctgacagaggtgcgggctctg
ctgcggaagcacgaggcgttcgagagcgacctggcagcgcaccaggaccgcgtggagcag
atcgcagccatcgcgcaggagctcaatgaactggactatcacgacgctgtgaatgtcaat
gatcggtgccagaaaatttgtgaccagtgggaccgactgggaacgcttactcagaagagg
agagaagccctagagagaatggagaaattgctagaaaccattgatcagcttcacctggag
tttgccaagagggctgctcctttcaacaattggatggagggcgctatggaggatctgcaa
gatatgttcattgtccacagcattgaggagatccagagtctgatcactgcgcatgagcag
ttcaaggccacgctgcccgaggcggacggagagcggcagtccatcatggccatccagaac
gaggtggagaaggtgattcagagctacaacatcagaatcagctcaagcaacccgtacagc
actgtcaccatggatgagctccggaccaagtgggacaaggtgaagcaactcgtgcccatc
cgcgatcaatccctgcaggaggagctggctcgccagcatgctaacgagcgtctgaggcgc
cagtttgctgcccaagccaatgccattgggccctggatccagaacaagatggaggagatt
gcccggagctccatccagatcacaggagccctggaagaccagatgaaccagctgaagcag
tatgagcacaacatcatcaactataagaacaacatcgacaagctggagggagaccatcag
ctcatccaggaggcccttgtctttgacaacaagcacacgaactacacgatggagcacatt
cgtgttggatgggagctgctgctgacaaccatcgccagaaccatcaatgaggtggagact
cagatcctgacgagagatgcgaagggcatcacccaggagcagatgaatgagttcagagcc
tccttcaaccactttgacaggaggaagaatggcctgatggatcatgaggatttcagagcc
tgcctgatttccatgggttatgacctgggtgaagccgaatttgcccgcattatgaccctg
gtagatcccaacgggcaaggcaccgtcaccttccaatccttcatcgacttcatgactaga
gagacggctgacaccgacactgccgagcaggtcatcgcctccttccggatcctggcttct
gataagccatacatcctggcggaggagctgcgtcgggagctgcccccggatcaggcccag
tactgcatcaagaggatgcccgcctactcgggcccaggcagtgtgcctggtgcactggat
tacgctgcgttctcttccgcactctacggggagagcgatctgtga

DBGET integrated database retrieval system