KEGG   Homo sapiens (human): 8801Help
Entry
8801              CDS       T01001                                 

Gene name
SUCLG2, GBETA
Definition
succinate-CoA ligase, GDP-forming, beta subunit (EC:6.2.1.4)
Orthology
K01900  
succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    8801 (SUCLG2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    8801 (SUCLG2)
   00640 Propanoate metabolism
    8801 (SUCLG2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     8801 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     8801 (SUCLG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8801 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p14.1
AA seq 440 aa AA seqDB search
MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFF
VADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQM
IGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEV
AASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQV
EVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD
GNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILV
NIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTFMEKKGSYMHIKQETGNSNENITG
IQENVAHQNLSKCAISIFLC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccccgtagcagcgcaggccgggaagcttctgcgagccctagcgctgcggccc
cgcttcctggcggccgggtcccaggcagttcaattaacctccagaagatggctgaacctg
caggaataccagagcaagaaactgatgtctgacaacggagtgagagttcaaagattcttt
gtagcagacactgcaaatgaagctctcgaggctgctaagagactaaatgcaaaagaaatt
gttttaaaagcccagatcttagctggaggaagaggaaaaggtgtcttcaatagtggtttg
aaaggaggtgttcatttaacaaaagaccctaatgttgtgggacagctggctaaacagatg
attgggtacaatctagcgacaaaacaaactccaaaagaaggtgtgaaagttaacaaggtg
atggttgctgaagccttggatatttccagagaaacctacctggcaattctgatggaccgg
tcctgcaatggccccgtgctggtgggcagcccccaggggggcgtcgacattgaagaggtg
gctgcttcaaacccggagctcatttttaaggagcaaattgacatttttgaaggaataaag
gacagccaagctcagcggatggccgaaaatctaggcttcgttgggcctttgaaaagccag
gctgcagatcaaattacgaagctgtataatctcttcctgaaaattgatgctactcaggtg
gaagtgaatccctttggtgaaactccagaaggacaagttgtctgttttgatgccaagata
aactttgatgacaacgcagaattccgacaaaaagacatatttgctatggacgacaaatca
gagaatgagcccattgaaaatgaagctgccaaatatgatctaaaatacataggactagat
gggaacattgcctgctttgtgaatggtgctgggctcgccatggctacttgtgatatcatt
ttccttaatggtgggaagccagccaacttcttggatcttggaggtggtgtaaaggaagct
caagtatatcaagcattcaaattgctcacagctgatcctaaggttgaagccatccttgtc
aatatatttggtggtatcgtcaactgtgccatcattgccaatgggatcaccaaagcctgc
cgggagctagaactcaaggtgcccctggtggtccggcttgaaggtacttttatggaaaaa
aaaggaagttatatgcacataaaacaagaaacaggaaattcaaatgagaatataactggt
atccaagagaacgtcgcccaccaaaatctgagtaagtgtgccatcagcatttttttatgt
taa

DBGET integrated database retrieval system