KEGG   Homo sapiens (human): 8807Help
Entry
8807              CDS       T01001                                 

Gene name
IL18RAP, ACPL, CD218b, CDw218b, IL18RB
Definition
interleukin 18 receptor accessory protein
Orthology
K05174  
interleukin 18 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Inflammatory bowel disease (IBD)
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q12
AA seq 599 aa AA seqDB search
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtttgggctggatatttctttggcttgttgcaggagagcgaattaaaggattt
aatatttcaggttgttccacaaaaaaactcctttggacatattctacaaggagtgaagag
gaatttgtcttattttgtgatttaccagagccacagaaatcacatttctgccacagaaat
cgactctcaccaaaacaagtccctgagcacctgcccttcatgggtagtaacgacctatct
gatgtccaatggtaccaacaaccttcgaatggagatccattagaggacattaggaaaagc
tatcctcacatcattcaggacaaatgtacccttcactttttgaccccaggggtgaataat
tctgggtcatatatttgtagacccaagatgattaagagcccctatgatgtagcctgttgt
gtcaagatgattttagaagttaagccccagacaaatgcatcctgtgagtattccgcatca
cataagcaagacctacttcttgggagcactggctctatttcttgccccagtctcagctgc
caaagtgatgcacaaagtccagcggtaacctggtacaagaatggaaaactcctctctgtg
gaaaggagcaaccgaatcgtagtggatgaagtttatgactatcaccagggcacatatgta
tgtgattacactcagtcggatactgtgagttcgtggacagtcagagctgttgttcaagtg
agaaccattgtgggagacactaaactcaaaccagatattctggatcctgtcgaggacaca
ctggaagtagaacttggaaagcctttaactattagctgcaaagcacgatttggctttgaa
agggtctttaaccctgtcataaaatggtacatcaaagattctgacctagagtgggaagtc
tcagtacctgaggcgaaaagtattaaatccactttaaaggatgaaatcattgagcgtaat
atcatcttggaaaaagtcactcagcgtgatcttcgcaggaagtttgtttgctttgtccag
aactccattggaaacacaacccagtccgtccaactgaaagaaaagagaggagtggtgctc
ctgtacatcctgcttggcaccatcgggaccctggtggccgtgctggcggcgagtgccctc
ctctacaggcactggattgaaatagtgctgctgtaccggacctaccagagcaaggatcag
acgcttggggataaaaaggattttgatgctttcgtatcctatgcaaaatggagctctttt
ccaagtgaggccacttcatctctgagtgaagaacacttggccctgagcctatttcctgat
gttttagaaaacaaatatggatatagcctgtgtttgcttgaaagagatgtggctccagga
ggagtgtatgcagaagacattgtgagcattattaagagaagcagaagaggaatatttatc
ttgagccccaactatgtcaatggacccagtatctttgaactacaagcagcagtgaatctt
gccttggatgatcaaacactgaaactcattttaattaagttctgttacttccaagagcca
gagtctctacctcatctcgtgaaaaaagctctcagggttttgcccacagttacttggaga
ggcttaaaatcagttcctcccaattctaggttctgggccaaaatgcgctaccacatgcct
gtgaaaaactctcagggattcacgtggaaccagctcagaattacctctaggatttttcag
tggaaaggactcagtagaacagaaaccactgggaggagctcccagcctaaggaatggtga

DBGET integrated database retrieval system