KEGG   Homo sapiens (human): 8807Help
Entry
8807              CDS       T01001                                 

Gene name
IL18RAP, ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
Definition
interleukin 18 receptor accessory protein
Orthology
K05174  
interleukin 18 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8807 (IL18RAP)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    8807 (IL18RAP)
Cellular antigens [BR:hsa04090]
 Proteins
  8807 (IL18RAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q12
AA seq 599 aa AA seqDB search
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtttgggctggatatttctttggcttgttgcaggagagcgaattaaaggattt
aatatttcaggttgttccacaaaaaaactcctttggacatattctacaaggagtgaagag
gaatttgtcttattttgtgatttaccagagccacagaaatcacatttctgccacagaaat
cgactctcaccaaaacaagtccctgagcacctgcccttcatgggtagtaacgacctatct
gatgtccaatggtaccaacaaccttcgaatggagatccattagaggacattaggaaaagc
tatcctcacatcattcaggacaaatgtacccttcactttttgaccccaggggtgaataat
tctgggtcatatatttgtagacccaagatgattaagagcccctatgatgtagcctgttgt
gtcaagatgattttagaagttaagccccagacaaatgcatcctgtgagtattccgcatca
cataagcaagacctacttcttgggagcactggctctatttcttgccccagtctcagctgc
caaagtgatgcacaaagtccagcggtaacctggtacaagaatggaaaactcctctctgtg
gaaaggagcaaccgaatcgtagtggatgaagtttatgactatcaccagggcacatatgta
tgtgattacactcagtcggatactgtgagttcgtggacagtcagagctgttgttcaagtg
agaaccattgtgggagacactaaactcaaaccagatattctggatcctgtcgaggacaca
ctggaagtagaacttggaaagcctttaactattagctgcaaagcacgatttggctttgaa
agggtctttaaccctgtcataaaatggtacatcaaagattctgacctagagtgggaagtc
tcagtacctgaggcgaaaagtattaaatccactttaaaggatgaaatcattgagcgtaat
atcatcttggaaaaagtcactcagcgtgatcttcgcaggaagtttgtttgctttgtccag
aactccattggaaacacaacccagtccgtccaactgaaagaaaagagaggagtggtgctc
ctgtacatcctgcttggcaccatcgggaccctggtggccgtgctggcggcgagtgccctc
ctctacaggcactggattgaaatagtgctgctgtaccggacctaccagagcaaggatcag
acgcttggggataaaaaggattttgatgctttcgtatcctatgcaaaatggagctctttt
ccaagtgaggccacttcatctctgagtgaagaacacttggccctgagcctatttcctgat
gttttagaaaacaaatatggatatagcctgtgtttgcttgaaagagatgtggctccagga
ggagtgtatgcagaagacattgtgagcattattaagagaagcagaagaggaatatttatc
ttgagccccaactatgtcaatggacccagtatctttgaactacaagcagcagtgaatctt
gccttggatgatcaaacactgaaactcattttaattaagttctgttacttccaagagcca
gagtctctacctcatctcgtgaaaaaagctctcagggttttgcccacagttacttggaga
ggcttaaaatcagttcctcccaattctaggttctgggccaaaatgcgctaccacatgcct
gtgaaaaactctcagggattcacgtggaaccagctcagaattacctctaggatttttcag
tggaaaggactcagtagaacagaaaccactgggaggagctcccagcctaaggaatggtga

DBGET integrated database retrieval system