KEGG   Homo sapiens (human): 8809Help
Entry
8809              CDS       T01001                                 

Gene name
IL18R1, CD218a, CDw218a, IL-1Rrp, IL18RA, IL1RRP
Definition
interleukin 18 receptor 1
Orthology
K05173  
interleukin 18 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TNF signaling pathway
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    8809 (IL18R1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8809 (IL18R1)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    8809 (IL18R1)
Cellular antigens [BR:hsa04090]
 Proteins
  8809 (IL18R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q12
AA seq 385 aa AA seqDB search
MNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVP
VLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGK
WHASKVLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKDMADIPGHVFTRGMIIAVL
ILVAVVCLVTVCVIYRVDLVLFYRHLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFA
VEILPRVLEKHFGYKLCIFERDVVPGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYEL
ESGLHEALVERKIKIILIEFTPVTDFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNL
LYLMPAKTVKPGRDEPEVLPVLSES
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtaaaaagctactactggagaacaataaaaacccaacgataaagaagaacgcc
gagtttgaagatcaggggtattactcctgcgtgcatttccttcatcataatggaaaacta
tttaatatcaccaaaaccttcaatataacaatagtggaagatcgcagtaatatagttccg
gttcttcttggaccaaagcttaaccatgttgcagtggaattaggaaaaaacgtaaggctc
aactgctctgctttgctgaatgaagaggatgtaatttattggatgttcggggaagaaaat
ggatcggatcctaatatacatgaagagaaagaaatgagaattatgactccagaaggcaaa
tggcatgcttcaaaagtattgagaattgaaaatattggtgaaagcaatctaaatgtttta
tataattgcactgtggccagcacgggaggcacagacaccaaaagcttcatcttggtgaga
aaagacatggctgatatcccaggccacgtcttcacaagaggaatgatcatagctgttttg
atcttggtggcagtagtgtgcctagtgactgtgtgtgtcatttatagagttgacttggtt
ctattttatagacatttaacgagaagagatgaaacattaacagatggaaaaacatatgat
gcttttgtgtcttacctaaaagaatgccgacctgaaaatggagaggagcacacctttgct
gtggagattttgcccagggtgttggagaaacattttgggtataagttatgcatatttgaa
agggatgtagtgcctggaggagctgttgttgatgaaatccactcactgatagagaaaagc
cgaagactaatcattgtcctaagtaaaagttatatgtctaatgaggtcaggtatgaactt
gaaagtggactccatgaagcattggtggaaagaaaaattaaaataatcttaattgaattt
acacctgttactgacttcacattcttgccccaatcactaaagcttttgaaatctcacaga
gttctgaagtggaaggccgataaatctctttcttataactcaaggttctggaagaacctt
ctttacttaatgcctgcaaaaacagtcaagccaggtagagacgaaccggaagtcttgcct
gttctttccgagtcttaa

DBGET integrated database retrieval system