KEGG   Homo sapiens (human): 8822Help
Entry
8822              CDS       T01001                                 

Gene name
FGF17, FGF-13, HH20
Definition
fibroblast growth factor 17
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Disease
H00255  
Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8822 (FGF17)
   04015 Rap1 signaling pathway
    8822 (FGF17)
   04010 MAPK signaling pathway
    8822 (FGF17)
   04151 PI3K-Akt signaling pathway
    8822 (FGF17)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8822 (FGF17)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8822 (FGF17)
   05218 Melanoma
    8822 (FGF17)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  8822 (FGF17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
8p21
AA seq 216 aa AA seqDB search
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcccaacctcactctgtgcttacagctgctgattctctgc
tgtcaaactcagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgccatgaccgaccagctgagcaggcggcagatccgcgagtaccaactctacagcagg
accagtggcaagcacgtgcaggtcaccgggcgtcgcatctccgccaccgccgaggacggc
aacaagtttgccaagctcatagtggagacggacacgtttggcagccgggttcgcatcaaa
ggggctgagagtgagaagtacatctgtatgaacaagaggggcaagctcatcgggaagccc
agcgggaagagcaaagactgcgtgttcacggagatcgtgctggagaacaactatacggcc
ttccagaacgcccggcacgagggctggttcatggccttcacgcggcaggggcggccccgc
caggcttcccgcagccgccagaaccagcgcgaggcccacttcatcaagcgcctctaccaa
ggccagctgcccttccccaaccacgccgagaagcagaagcagttcgagtttgtgggctcc
gcccccacccgccggaccaagcgcacacggcggccccagcccctcacgtag

DBGET integrated database retrieval system