KEGG   Homo sapiens (human): 8823Help
Entry
8823              CDS       T01001                                 

Gene name
FGF16, FGF-16, MF4
Definition
fibroblast growth factor 16
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8823 (FGF16)
   04015 Rap1 signaling pathway
    8823 (FGF16)
   04010 MAPK signaling pathway
    8823 (FGF16)
   04151 PI3K-Akt signaling pathway
    8823 (FGF16)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8823 (FGF16)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8823 (FGF16)
   05218 Melanoma
    8823 (FGF16)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  8823 (FGF16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xq13
AA seq 207 aa AA seqDB search
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFHYR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctcg
tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa
atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctaaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacgggacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggct
gtggggctgatcagcatccggggagtggactctggcctgtacctaggaatgaatgagcga
ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcctcaaccttgtacaaacattcggactcagagagacag
tattacgtggccctgaacaaagatggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc
agagacctctttcactataggtaa

DBGET integrated database retrieval system