KEGG   Homo sapiens (human): 8824Help
Entry
8824              CDS       T01001                                 

Gene name
CES2, CE-2, CES2A1, PCE-2, iCE
Definition
carboxylesterase 2 (EC:3.1.1.1 3.1.1.84 3.1.1.56)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
hsa  Homo sapiens (human)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    8824 (CES2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     8824 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     8824 (CES2)
    3.1.1.84  cocaine esterase
     8824 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 623 aa AA seqDB search
MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTET
SEPTMRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQ
TFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPS
DSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQ
YRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSS
LVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKS
KEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI
YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMF
VIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKF
TEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQ
FWKKALPQKIQELEEPEERHTEL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagtcccgctctcctaccacacccacctttcccggcccaagccagcgcacc
ccgctgactccctgcccagtccaaactccaaggctgggcaaggcactgatccactgctgg
acagacccggggcagcctctgggtgaacagcagcgtgtccgccggcagcgaaccgagacc
agcgagccgaccatgcggctgcacagacttcgtgcgcggctgagcgcggtggcctgtggg
cttctgctgcttcttgtccggggccagggccaggactcagccagtcccatccggaccaca
cacacggggcaggtgctggggagtcttgtccatgtgaagggcgccaatgccggggtccaa
accttcctgggaattccatttgccaagccacctctaggtccgctgcgatttgcaccccct
gagccccctgaatcttggagtggtgtgagggatggaaccacccatccggccatgtgtcta
caggacctcaccgcagtggagtcagagtttcttagccagttcaacatgaccttcccttcc
gactccatgtctgaggactgcctgtacctcagcatctacacgccggcccatagccatgaa
ggctctaacctgccggtgatggtgtggatccacggtggtgcgcttgtttttggcatggct
tccttgtatgatggttccatgctggctgccttggagaacgtggtggtggtcatcatccag
taccgcctgggtgtcctgggcttcttcagcactggagacaagcacgcaaccggcaactgg
ggctacctggaccaagtggctgcactacgctgggtccagcagaatatcgcccactttgga
ggcaaccctgaccgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcg
cttgttgtgtcccccatatcccaaggactcttccacggagccatcatggagagtggcgtg
gccctcctgcccggcctcattgccagctcagctgatgtcatctccacggtggtggccaac
ctgtctgcctgtgaccaagttgactctgaggccctggtgggctgcctgcggggcaagagt
aaagaggagattcttgcaattaacaagcctttcaagatgatccccggagtggtggatggg
gtcttcctgcccaggcacccccaggagctgctggcctctgccgactttcagcctgtccct
agcattgttggtgtcaacaacaatgaattcggctggctcatccccaaggtcatgaggatc
tatgatacccagaaggaaatggacagagaggcctcccaggctgctctgcagaaaatgtta
acgctgctgatgttgcctcctacatttggtgacctgctgagggaggagtacattggggac
aatggggatccccagaccctccaagcgcagttccaggagatgatggcggactccatgttt
gtgatccctgcactccaagtagcacattttcagtgttcccgggcccctgtgtacttctac
gagttccagcatcagcccagctggctcaagaacatcaggccaccgcacatgaaggcagac
catggtgatgagcttccttttgttttcagaagtttctttgggggcaactacattaaattc
actgaggaagaggagcagctaagcaggaagatgatgaagtactgggccaactttgcgaga
aatgggaaccccaatggcgagggtctgccacactggccgctgttcgaccaggaggagcaa
tacctgcagctgaacctacagcctgcggtgggccgggctctgaaggcccacaggctccag
ttctggaagaaggcgctgccccaaaagatccaggagctcgaggagcctgaagagagacac
acagagctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system