KEGG   Homo sapiens (human): 8824Help
Entry
8824              CDS       T01001                                 

Gene name
CES2, CE-2, CES2A1, PCE-2, iCE
Definition
carboxylesterase 2 (EC:3.1.1.1 3.1.1.84 3.1.1.56)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
hsa  Homo sapiens (human)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hsa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 623 aa AA seqDB search
MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTET
SEPTMRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQ
TFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPS
DSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQ
YRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSS
LVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKS
KEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI
YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMF
VIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKF
TEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQ
FWKKALPQKIQELEEPEERHTEL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagtcccgctctcctaccacacccacctttcccggcccaagccagcgcacc
ccgctgactccctgcccagtccaaactccaaggctgggcaaggcactgatccactgctgg
acagacccggggcagcctctgggtgaacagcagcgtgtccgccggcagcgaaccgagacc
agcgagccgaccatgcggctgcacagacttcgtgcgcggctgagcgcggtggcctgtggg
cttctgctgcttcttgtccggggccagggccaggactcagccagtcccatccggaccaca
cacacggggcaggtgctggggagtcttgtccatgtgaagggcgccaatgccggggtccaa
accttcctgggaattccatttgccaagccacctctaggtccgctgcgatttgcaccccct
gagccccctgaatcttggagtggtgtgagggatggaaccacccatccggccatgtgtcta
caggacctcaccgcagtggagtcagagtttcttagccagttcaacatgaccttcccttcc
gactccatgtctgaggactgcctgtacctcagcatctacacgccggcccatagccatgaa
ggctctaacctgccggtgatggtgtggatccacggtggtgcgcttgtttttggcatggct
tccttgtatgatggttccatgctggctgccttggagaacgtggtggtggtcatcatccag
taccgcctgggtgtcctgggcttcttcagcactggagacaagcacgcaaccggcaactgg
ggctacctggaccaagtggctgcactacgctgggtccagcagaatatcgcccactttgga
ggcaaccctgaccgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcg
cttgttgtgtcccccatatcccaaggactcttccacggagccatcatggagagtggcgtg
gccctcctgcccggcctcattgccagctcagctgatgtcatctccacggtggtggccaac
ctgtctgcctgtgaccaagttgactctgaggccctggtgggctgcctgcggggcaagagt
aaagaggagattcttgcaattaacaagcctttcaagatgatccccggagtggtggatggg
gtcttcctgcccaggcacccccaggagctgctggcctctgccgactttcagcctgtccct
agcattgttggtgtcaacaacaatgaattcggctggctcatccccaaggtcatgaggatc
tatgatacccagaaggaaatggacagagaggcctcccaggctgctctgcagaaaatgtta
acgctgctgatgttgcctcctacatttggtgacctgctgagggaggagtacattggggac
aatggggatccccagaccctccaagcgcagttccaggagatgatggcggactccatgttt
gtgatccctgcactccaagtagcacattttcagtgttcccgggcccctgtgtacttctac
gagttccagcatcagcccagctggctcaagaacatcaggccaccgcacatgaaggcagac
catggtgatgagcttccttttgttttcagaagtttctttgggggcaactacattaaattc
actgaggaagaggagcagctaagcaggaagatgatgaagtactgggccaactttgcgaga
aatgggaaccccaatggcgagggtctgccacactggccgctgttcgaccaggaggagcaa
tacctgcagctgaacctacagcctgcggtgggccgggctctgaaggcccacaggctccag
ttctggaagaaggcgctgccccaaaagatccaggagctcgaggagcctgaagagagacac
acagagctgtag

DBGET integrated database retrieval system