KEGG   Homo sapiens (human): 8826Help
Entry
8826              CDS       T01001                                 

Gene name
IQGAP1, HUMORFA01, SAR1, p195
Definition
IQ motif containing GTPase activating protein 1
Orthology
K16848  
Ras GTPase-activating-like protein IQGAP1
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8826 (IQGAP1)
  Cellular commiunity
   04520 Adherens junction
    8826 (IQGAP1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    8826 (IQGAP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8826 (IQGAP1)
  Exosomal proteins of breast milk
   8826 (IQGAP1)
  Exosomal proteins of other body fluids (saliva and urine)
   8826 (IQGAP1)
  Exosomal proteins of colorectal cancer cells
   8826 (IQGAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.1
AA seq 1657 aa AA seqDB search
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcagacgaggttgacgggctgggcgtggcccggccgcactatggctctgtc
ctggataatgaaagacttactgcagaggagatggatgaaaggagacgtcagaacgtggct
tatgagtacctttgtcatttggaagaagcgaagaggtggatggaagcatgcctaggggaa
gatctgcctcccaccacagaactggaggaggggcttaggaatggggtctaccttgccaaa
ctggggaacttcttctctcccaaagtagtgtccctgaaaaaaatctatgatcgagaacag
accagatacaaggcgactggcctccactttagacacactgataatgtgattcagtggttg
aatgccatggatgagattggattgcctaagattttttacccagaaactacagatatctat
gatcgaaagaacatgccaagatgtatctactgtatccatgcactcagtttgtacctgttc
aagctaggcctggcccctcagattcaagacctatatggaaaggttgacttcacagaagaa
gaaatcaacaacatgaagactgagttggagaagtatggcatccagatgcctgcctttagc
aagattgggggcatcttggctaatgaactgtcagtggatgaagccgcattacatgctgct
gttattgctattaatgaagctattgaccgtagaattccagccgacacatttgcagctttg
aaaaatccgaatgccatgcttgtaaatcttgaagagcccttggcatccacttaccaggat
atactttaccaggctaagcaggacaaaatgacaaatgctaaaaacaggacagaaaactca
gagagagaaagagatgtttatgaggagctgctcacgcaagctgaaattcaaggcaatata
aacaaagtcaatacattttctgcattagcaaatatcgacctggctttagaacaaggagat
gcactggccttgttcagggctctgcagtcaccagccctggggcttcgaggactgcagcaa
cagaatagcgactggtacttgaagcagctcctgagtgataaacagcagaagagacagagt
ggtcagactgaccccctgcagaaggaggagctgcagtctggagtggatgctgcaaacagt
gctgcccagcaatatcagagaagattggcagcagtagcactgattaatgctgcaatccag
aagggtgttgctgagaagactgttttggaactgatgaatcccgaagcccagctgccccag
gtgtatccatttgccgccgatctctatcagaaggagctggctaccctgcagcgacaaagt
cctgaacataatctcacccacccagagctctctgtcgcagtggagatgttgtcatcggtg
gccctgatcaacagggcattggaatcaggagatgtgaatacagtgtggaagcaattgagc
agttcagttactggtcttaccaatattgaggaagaaaactgtcagaggtatctcgatgag
ttgatgaaactgaaggctcaggcacatgcagagaataatgaattcattacatggaatgat
atccaagcttgcgtggaccatgtgaacctggtggtgcaagaggaacatgagaggatttta
gccattggtttaattaatgaagccctggatgaaggtgatgcccaaaagactctgcaggcc
ctacagattcctgcagctaaacttgagggagtccttgcagaagtggcccagcattaccaa
gacacgctgattagagcgaagagagagaaagcccaggaaatccaggatgagtcagctgtg
ttatggttggatgaaattcaaggtggaatctggcagtccaacaaagacacccaagaagca
cagaagtttgccttaggaatctttgccattaatgaggcagtagaaagtggtgatgttggc
aaaacactgagtgcccttcgctcccctgatgttggcttgtatggagtcatccctgagtgt
ggtgaaacttaccacagtgatcttgctgaagccaagaagaaaaaactggcagtaggagat
aataacagcaagtgggtgaagcactgggtaaaaggtggatattattattaccacaatctg
gagacccaggaaggaggatgggatgaacctccaaattttgtgcaaaattctatgcagctt
tctcgggaggagatccagagttctatctctggggtgactgccgcatataaccgagaacag
ctgtggctggccaatgaaggcctgatcaccaggctgcaggctcgctgccgtggatactta
gttcgacaggaattccgatccaggatgaatttcctgaagaaacaaatccctgccatcacc
tgcattcagtcacagtggagaggatacaagcagaagaaggcatatcaagatcggttagct
tacctgcgctcccacaaagatgaagttgtaaagattcagtccctggcaaggatgcaccaa
gctcgaaagcgctatcgagatcgcctgcagtacttccgggaccatataaatgacattatc
aaaatccaggcttttattcgggcaaacaaagctcgggatgactacaagactctcatcaat
gctgaggatcctcctatggttgtggtccgaaaatttgtccacctgctggaccaaagtgac
caggattttcaggaggagcttgaccttatgaagatgcgggaagaggttatcaccctcatt
cgttctaaccagcagctggagaatgacctcaatctcatggatatcaaaattggactgcta
gtgaaaaataagattacgttgcaggatgtggtttcccacagtaaaaaacttaccaaaaaa
aataaggaacagttgtctgatatgatgatgataaataaacagaagggaggtctcaaggct
ttgagcaaggagaagagagagaagttggaagcttaccagcacctgttttatttattgcaa
accaatcccacctatctggccaagctcatttttcagatgccccagaacaagtccaccaag
ttcatggactctgtaatcttcacactctacaactacgcgtccaaccagcgagaggagtac
ctgctcctgcggctctttaagacagcactccaagaggaaatcaagtcgaaggtagatcag
attcaagagattgtgacaggaaatcctacggttattaaaatggttgtaagtttcaaccgt
ggtgcccgtggccagaatgccctgagacagatcttggccccagtcgtgaaggaaattatg
gatgacaaatctctcaacatcaaaactgaccctgtggatatttacaaatcttgggttaat
cagatggagtctcagacaggagaggcaagcaaactgccctatgatgtgacccctgagcag
gcgctagctcatgaagaagtgaagacacggctagacagctccatcaggaacatgcgggct
gtgacagacaagtttctctcagccattgtcagctctgtggacaaaatcccttatgggatg
cgcttcattgccaaagtgctgaaggactcgttgcatgagaagttccctgatgctggtgag
gatgagctgctgaagattattggtaacttgctttattatcgatacatgaatccagccatt
gttgctcctgatgcctttgacatcattgacctgtcagcaggaggccagcttaccacagac
caacgccgaaatctgggctccattgcaaaaatgcttcagcatgctgcttccaataagatg
tttctgggagataatgcccacttaagcatcattaatgaatatctttcccagtcctaccag
aaattcagacggtttttccaaactgcttgtgatgtcccagagcttcaggataaatttaat
gtggatgagtactctgatttagtaaccctcaccaaaccagtaatctacatttccattggt
gaaatcatcaacacccacactctcctgttggatcaccaggatgccattgctccggagcac
aatgatccaatccacgaactgctggacgacctcggcgaggtgcccaccatcgagtccctg
ataggggaaagctctggcaatttaaatgacccaaataaggaggcactggctaagacggaa
gtgtctctcaccctgaccaacaagttcgacgtgcctggagatgagaatgcagaaatggat
gctcgaaccatcttactgaatacaaaacgtttaattgtggatgtcatccggttccagcca
ggagagaccttgactgaaatcctagaaacaccagccaccagtgaacaggaagcagaacat
cagagagccatgcagagacgtgctatccgtgatgccaaaacacctgacaagatgaaaaag
tcaaaatctgtaaaggaagacagcaacctcactcttcaagagaagaaagagaagatccag
acaggtttaaagaagctaacagagcttggaaccgtggacccaaagaacaaataccaggaa
ctgatcaacgacattgccagggatattcggaatcagcggaggtaccgacagaggagaaag
gccgaactagtgaaactgcaacagacatacgctgctctgaactctaaggccaccttttat
ggggagcaggtggattactataaaagctatatcaaaacctgcttggataacttagccagc
aagggcaaagtctccaaaaagcctagggaaatgaaaggaaagaaaagcaaaaagatttct
ctgaaatatacagcagcaagactacatgaaaaaggagttcttctggaaattgaggacctg
caagtgaatcagtttaaaaatgttatatttgaaatcagtccaacagaagaagttggagac
ttcgaagtgaaagccaaattcatgggagttcaaatggagacttttatgttacattatcag
gacctgctgcagctacagtatgaaggagttgcagtcatgaaattatttgatagagctaaa
gtaaatgtcaacctcctgatcttccttctcaacaaaaagttctacgggaagtaa

DBGET integrated database retrieval system