KEGG   Homo sapiens (human): 8826Help
Entry
8826              CDS       T01001                                 

Gene name
IQGAP1, HUMORFA01, SAR1, p195
Definition
IQ motif containing GTPase activating protein 1
Orthology
K16848  
Ras GTPase-activating-like protein IQGAP1
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.1
AA seq 1657 aa AA seqDB search
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcagacgaggttgacgggctgggcgtggcccggccgcactatggctctgtc
ctggataatgaaagacttactgcagaggagatggatgaaaggagacgtcagaacgtggct
tatgagtacctttgtcatttggaagaagcgaagaggtggatggaagcatgcctaggggaa
gatctgcctcccaccacagaactggaggaggggcttaggaatggggtctaccttgccaaa
ctggggaacttcttctctcccaaagtagtgtccctgaaaaaaatctatgatcgagaacag
accagatacaaggcgactggcctccactttagacacactgataatgtgattcagtggttg
aatgccatggatgagattggattgcctaagattttttacccagaaactacagatatctat
gatcgaaagaacatgccaagatgtatctactgtatccatgcactcagtttgtacctgttc
aagctaggcctggcccctcagattcaagacctatatggaaaggttgacttcacagaagaa
gaaatcaacaacatgaagactgagttggagaagtatggcatccagatgcctgcctttagc
aagattgggggcatcttggctaatgaactgtcagtggatgaagccgcattacatgctgct
gttattgctattaatgaagctattgaccgtagaattccagccgacacatttgcagctttg
aaaaatccgaatgccatgcttgtaaatcttgaagagcccttggcatccacttaccaggat
atactttaccaggctaagcaggacaaaatgacaaatgctaaaaacaggacagaaaactca
gagagagaaagagatgtttatgaggagctgctcacgcaagctgaaattcaaggcaatata
aacaaagtcaatacattttctgcattagcaaatatcgacctggctttagaacaaggagat
gcactggccttgttcagggctctgcagtcaccagccctggggcttcgaggactgcagcaa
cagaatagcgactggtacttgaagcagctcctgagtgataaacagcagaagagacagagt
ggtcagactgaccccctgcagaaggaggagctgcagtctggagtggatgctgcaaacagt
gctgcccagcaatatcagagaagattggcagcagtagcactgattaatgctgcaatccag
aagggtgttgctgagaagactgttttggaactgatgaatcccgaagcccagctgccccag
gtgtatccatttgccgccgatctctatcagaaggagctggctaccctgcagcgacaaagt
cctgaacataatctcacccacccagagctctctgtcgcagtggagatgttgtcatcggtg
gccctgatcaacagggcattggaatcaggagatgtgaatacagtgtggaagcaattgagc
agttcagttactggtcttaccaatattgaggaagaaaactgtcagaggtatctcgatgag
ttgatgaaactgaaggctcaggcacatgcagagaataatgaattcattacatggaatgat
atccaagcttgcgtggaccatgtgaacctggtggtgcaagaggaacatgagaggatttta
gccattggtttaattaatgaagccctggatgaaggtgatgcccaaaagactctgcaggcc
ctacagattcctgcagctaaacttgagggagtccttgcagaagtggcccagcattaccaa
gacacgctgattagagcgaagagagagaaagcccaggaaatccaggatgagtcagctgtg
ttatggttggatgaaattcaaggtggaatctggcagtccaacaaagacacccaagaagca
cagaagtttgccttaggaatctttgccattaatgaggcagtagaaagtggtgatgttggc
aaaacactgagtgcccttcgctcccctgatgttggcttgtatggagtcatccctgagtgt
ggtgaaacttaccacagtgatcttgctgaagccaagaagaaaaaactggcagtaggagat
aataacagcaagtgggtgaagcactgggtaaaaggtggatattattattaccacaatctg
gagacccaggaaggaggatgggatgaacctccaaattttgtgcaaaattctatgcagctt
tctcgggaggagatccagagttctatctctggggtgactgccgcatataaccgagaacag
ctgtggctggccaatgaaggcctgatcaccaggctgcaggctcgctgccgtggatactta
gttcgacaggaattccgatccaggatgaatttcctgaagaaacaaatccctgccatcacc
tgcattcagtcacagtggagaggatacaagcagaagaaggcatatcaagatcggttagct
tacctgcgctcccacaaagatgaagttgtaaagattcagtccctggcaaggatgcaccaa
gctcgaaagcgctatcgagatcgcctgcagtacttccgggaccatataaatgacattatc
aaaatccaggcttttattcgggcaaacaaagctcgggatgactacaagactctcatcaat
gctgaggatcctcctatggttgtggtccgaaaatttgtccacctgctggaccaaagtgac
caggattttcaggaggagcttgaccttatgaagatgcgggaagaggttatcaccctcatt
cgttctaaccagcagctggagaatgacctcaatctcatggatatcaaaattggactgcta
gtgaaaaataagattacgttgcaggatgtggtttcccacagtaaaaaacttaccaaaaaa
aataaggaacagttgtctgatatgatgatgataaataaacagaagggaggtctcaaggct
ttgagcaaggagaagagagagaagttggaagcttaccagcacctgttttatttattgcaa
accaatcccacctatctggccaagctcatttttcagatgccccagaacaagtccaccaag
ttcatggactctgtaatcttcacactctacaactacgcgtccaaccagcgagaggagtac
ctgctcctgcggctctttaagacagcactccaagaggaaatcaagtcgaaggtagatcag
attcaagagattgtgacaggaaatcctacggttattaaaatggttgtaagtttcaaccgt
ggtgcccgtggccagaatgccctgagacagatcttggccccagtcgtgaaggaaattatg
gatgacaaatctctcaacatcaaaactgaccctgtggatatttacaaatcttgggttaat
cagatggagtctcagacaggagaggcaagcaaactgccctatgatgtgacccctgagcag
gcgctagctcatgaagaagtgaagacacggctagacagctccatcaggaacatgcgggct
gtgacagacaagtttctctcagccattgtcagctctgtggacaaaatcccttatgggatg
cgcttcattgccaaagtgctgaaggactcgttgcatgagaagttccctgatgctggtgag
gatgagctgctgaagattattggtaacttgctttattatcgatacatgaatccagccatt
gttgctcctgatgcctttgacatcattgacctgtcagcaggaggccagcttaccacagac
caacgccgaaatctgggctccattgcaaaaatgcttcagcatgctgcttccaataagatg
tttctgggagataatgcccacttaagcatcattaatgaatatctttcccagtcctaccag
aaattcagacggtttttccaaactgcttgtgatgtcccagagcttcaggataaatttaat
gtggatgagtactctgatttagtaaccctcaccaaaccagtaatctacatttccattggt
gaaatcatcaacacccacactctcctgttggatcaccaggatgccattgctccggagcac
aatgatccaatccacgaactgctggacgacctcggcgaggtgcccaccatcgagtccctg
ataggggaaagctctggcaatttaaatgacccaaataaggaggcactggctaagacggaa
gtgtctctcaccctgaccaacaagttcgacgtgcctggagatgagaatgcagaaatggat
gctcgaaccatcttactgaatacaaaacgtttaattgtggatgtcatccggttccagcca
ggagagaccttgactgaaatcctagaaacaccagccaccagtgaacaggaagcagaacat
cagagagccatgcagagacgtgctatccgtgatgccaaaacacctgacaagatgaaaaag
tcaaaatctgtaaaggaagacagcaacctcactcttcaagagaagaaagagaagatccag
acaggtttaaagaagctaacagagcttggaaccgtggacccaaagaacaaataccaggaa
ctgatcaacgacattgccagggatattcggaatcagcggaggtaccgacagaggagaaag
gccgaactagtgaaactgcaacagacatacgctgctctgaactctaaggccaccttttat
ggggagcaggtggattactataaaagctatatcaaaacctgcttggataacttagccagc
aagggcaaagtctccaaaaagcctagggaaatgaaaggaaagaaaagcaaaaagatttct
ctgaaatatacagcagcaagactacatgaaaaaggagttcttctggaaattgaggacctg
caagtgaatcagtttaaaaatgttatatttgaaatcagtccaacagaagaagttggagac
ttcgaagtgaaagccaaattcatgggagttcaaatggagacttttatgttacattatcag
gacctgctgcagctacagtatgaaggagttgcagtcatgaaattatttgatagagctaaa
gtaaatgtcaacctcctgatcttccttctcaacaaaaagttctacgggaagtaa

DBGET integrated database retrieval system