KEGG   Homo sapiens (human): 8828Help
Entry
8828              CDS       T01001                                 

Gene name
NRP2, NP2, NPN2, PRO2714, VEGF165R2
Definition
(RefSeq) neuropilin 2
  KO
K06819  
neuropilin 2
Organism
hsa  Homo sapiens (human)
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     8828 (NRP2)
    CHL1; L1 cell adhesion molecule like protein [KO:K06758]
     8828 (NRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.3
AA seq 931 aa AA seqDB search
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYD
HAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtttcctctcacctgggttttcttagccctctacttttcaagacaccaagtg
agaggccaaccagacccaccgtgcggaggtcgtttgaattccaaagatgctggctatatc
acctctcccggttacccccaggactacccctcccaccagaactgcgagtggattgtttac
gcccccgaacccaaccagaagattgtcctcaacttcaaccctcactttgaaatcgagaag
cacgactgcaagtatgactttatcgagattcgggatggggacagtgaatccgcagacctc
ctgggcaaacactgtgggaacatcgccccgcccaccatcatctcctcgggctccatgctc
tacatcaagttcacctccgactacgcccggcagggggcaggcttctctctgcgctacgag
atcttcaagacaggctctgaagattgctcaaaaaacttcacaagccccaacgggaccatc
gaatctcctgggtttcctgagaagtatccacacaacttggactgcacctttaccatcctg
gccaaacccaagatggagatcatcctgcagttcctgatctttgacctggagcatgaccct
ttgcaggtgggagagggggactgcaagtacgattggctggacatctgggatggcattcca
catgttggccccctgattggcaagtactgtgggaccaaaacaccctctgaacttcgttca
tcgacggggatcctctccctgacctttcacacggacatggcggtggccaaggatggcttc
tctgcgcgttactacctggtccaccaagagccactagagaactttcagtgcaatgttcct
ctgggcatggagtctggccggattgctaatgaacagatcagtgcctcatctacctactct
gatgggaggtggacccctcaacaaagccggctccatggtgatgacaatggctggaccccc
aacttggattccaacaaggagtatctccaggtggacctgcgctttttaaccatgctcacg
gccatcgcaacacagggagcgatttccagggaaacacagaatggctactatgtcaaatcc
tacaagctggaagtcagcactaatggagaggactggatggtgtaccggcatggcaaaaac
cacaaggtatttcaagccaacaacgatgcaactgaggtggttctgaacaagctccacgct
ccactgctgacaaggtttgttagaatccgccctcagacctggcactcaggtatcgccctc
cggctggagctcttcggctgccgggtcacagatgctccctgctccaacatgctggggatg
ctctcaggcctcattgcagactcccagatctccgcctcttccacccaggaatacctctgg
agccccagtgcagcccgcctggtcagcagccgctcgggctggttccctcgaatccctcag
gcccagcccggtgaggagtggcttcaggtagatctgggaacacccaagacagtgaaaggt
gtcatcatccagggagcccgcggaggagacagtatcactgctgtggaagccagagcattt
gtgcgcaagttcaaagtctcctacagcctaaacggcaaggactgggaatacattcaggac
cccaggacccagcagccaaagctgttcgaagggaacatgcactatgacacccctgacatc
cgaaggtttgaccccattccggcacagtatgtgcgggtatacccggagaggtggtcgccg
gcggggattgggatgcggctggaggtgctgggctgtgactggacagactccaagcccacg
gtagagacgctgggacccactgtgaagagcgaagagacaaccaccccctaccccaccgaa
gaggaggccacagagtgtggggagaactgcagctttgaggatgacaaagatttgcagctc
ccttcgggattcaattgcaacttcgatttcctcgaggagccctgtggttggatgtatgac
catgccaagtggctccggaccacctgggccagcagctccagcccaaacgaccggacgttt
ccagatgacaggaatttcttgcggctgcagagtgacagccagagagagggccagtatgcc
cggctcatcagcccccctgtccacctgccccgaagcccggtgtgcatggagttccagtac
caggccacgggcggccgcggggtggcgctgcaggtggtgcgggaagccagccaggagagc
aagttgctgtgggtcatccgtgaggaccagggcggcgagtggaagcacgggcggatcatc
ctgcccagctacgacatggagtaccagattgtgttcgagggagtgatagggaaaggacgt
tccggagagattgccattgatgacattcggataagcactgatgtcccactggagaactgc
atggaacccatctcggcttttgcaggtgagaattttaaagtggacatcccagaaatacat
gagagagaaggatatgaagatgaaattgatgatgaatacgaggtggactggagcaattct
tcttctgcaacctcagggtctggcgccccctcgaccgacaaagaaaagagctggctgtac
accctggatcccatcctcatcaccatcatcgccatgagctcactgggcgtcctcctgggg
gccacctgtgcaggcctcctgctctactgcacctgttcctactcgggcctgagctcccga
agctgcaccacactggagaactacaacttcgagctctacgatggccttaagcacaaggtc
aagatgaaccaccaaaagtgctgctccgaggcatga

DBGET integrated database retrieval system