KEGG   Homo sapiens (human): 8829Help
Entry
8829              CDS       T01001                                 

Gene name
NRP1, BDCA4, CD304, NP1, NRP, VEGF165R
Definition
(RefSeq) neuropilin 1
  KO
K06724  
neuropilin 1
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
HTLV-I infection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    8829 (NRP1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    8829 (NRP1)
Cellular antigens [BR:hsa04090]
 Proteins
  8829 (NRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p12
AA seq 923 aa AA seqDB search
MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
INEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
FELVDGVKLKKDKLNTQSTYSEA
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggagagggggctgccgctcctctgcgccgtgctcgccctcgtcctcgccccggccggc
gcttttcgcaacgataaatgtggcgatactataaaaattgaaagccccgggtaccttaca
tctcctggttatcctcattcttatcacccaagtgaaaaatgcgaatggctgattcaggct
ccggacccataccagagaattatgatcaacttcaaccctcacttcgatttggaggacaga
gactgcaagtatgactacgtggaagtcttcgatggagaaaatgaaaatggacattttagg
ggaaagttctgtggaaagatagcccctcctcctgttgtgtcttcagggccatttcttttt
atcaaatttgtctctgactacgaaacacatggtgcaggattttccatacgttatgaaatt
ttcaagagaggtcctgaatgttcccagaactacacaacacctagtggagtgataaagtcc
cccggattccctgaaaaatatcccaacagccttgaatgcacttatattgtctttgcgcca
aagatgtcagagattatcctggaatttgaaagctttgacctggagcctgactcaaatcct
ccaggggggatgttctgtcgctacgaccggctagaaatctgggatggattccctgatgtt
ggccctcacattgggcgttactgtggacagaaaacaccaggtcgaatccgatcctcatcg
ggcattctctccatggttttttacaccgacagcgcgatagcaaaagaaggtttctcagca
aactacagtgtcttgcagagcagtgtctcagaagatttcaaatgtatggaagctctgggc
atggaatcaggagaaattcattctgaccagatcacagcttcttcccagtatagcaccaac
tggtctgcagagcgctcccgcctgaactaccctgagaatgggtggactcccggagaggat
tcctaccgagagtggatacaggtagacttgggccttctgcgctttgtcacggctgtcggg
acacagggcgccatttcaaaagaaaccaagaagaaatattatgtcaagacttacaagatc
gacgttagctccaacggggaagactggatcaccataaaagaaggaaacaaacctgttctc
tttcagggaaacaccaaccccacagatgttgtggttgcagtattccccaaaccactgata
actcgatttgtccgaatcaagcctgcaacttgggaaactggcatatctatgagatttgaa
gtatacggttgcaagataacagattatccttgctctggaatgttgggtatggtgtctgga
cttatttctgactcccagatcacatcatccaaccaaggggacagaaactggatgcctgaa
aacatccgcctggtaaccagtcgctctggctgggcacttccacccgcacctcattcctac
atcaatgagtggctccaaatagacctgggggaggagaagatcgtgaggggcatcatcatt
cagggtgggaagcaccgagagaacaaggtgttcatgaggaagttcaagatcgggtacagc
aacaacggctcggactggaagatgatcatggatgacagcaaacgcaaggcgaagtctttt
gagggcaacaacaactatgatacacctgagctgcggacttttccagctctctccacgcga
ttcatcaggatctaccccgagagagccactcatggcggactggggctcagaatggagctg
ctgggctgtgaagtggaagcccctacagctggaccgaccactcccaacgggaacttggtg
gatgaatgtgatgacgaccaggccaactgccacagtggaacaggtgatgacttccagctc
acaggtggcaccactgtgctggccacagaaaagcccacggtcatagacagcaccatacaa
tcagagtttccaacatatggttttaactgtgaatttggctggggctctcacaagaccttc
tgccactgggaacatgacaatcacgtgcagctcaagtggagtgtgttgaccagcaagacg
ggacccattcaggatcacacaggagatggcaacttcatctattcccaagctgacgaaaat
cagaagggcaaagtggctcgcctggtgagccctgtggtttattcccagaactctgcccac
tgcatgaccttctggtatcacatgtctgggtcccacgtcggcacactcagggtcaaactg
cgctaccagaagccagaggagtacgatcagctggtctggatggccattggacaccaaggt
gaccactggaaggaagggcgtgtcttgctccacaagtctctgaaactttatcaggtgatt
ttcgagggcgaaatcggaaaaggaaaccttggtgggattgctgtggatgacattagtatt
aataaccacatttcacaagaagattgtgcaaaaccagcagacctggataaaaagaaccca
gaaattaaaattgatgaaacagggagcacgccaggatacgaaggtgaaggagaaggtgac
aagaacatctccaggaagccaggcaatgtgttgaagaccttagaccccatcctcatcacc
atcatagccatgagtgccctgggggtcctcctgggggctgtctgtggggtcgtgctgtac
tgtgcctgttggcataatgggatgtcagaaagaaacttgtctgccctggagaactataac
tttgaacttgtggatggtgtgaagttgaaaaaagacaaactgaatacacagagtacttat
tcggaggcatga

DBGET integrated database retrieval system