KEGG   Homo sapiens (human): 8832Help
Entry
8832              CDS       T01001                                 

Gene name
CD84, LY9B, SLAMF5, hCD84, mCD84
Definition
(RefSeq) CD84 molecule
  KO
K06511  CD84 antigen
Organism
hsa  Homo sapiens (human)
Brite
CD molecules [BR:hsa04090]
 Proteins
  8832 (CD84)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set Izumo-Ig Ig_4
Motif
Other DBs
NCBI-GeneID: 8832
NCBI-ProteinID: NP_001171808
OMIM: 604513
HGNC: 1704
Ensembl: ENSG00000066294
Vega: OTTHUMG00000022788
Pharos: Q9UIB8(Tbio)
UniProt: Q9UIB8
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 345 aa AA seqDB search
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSV
AYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTT
TKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLIL
SSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEIL
QSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaccacctatggatcttgctcctttgcctgcaaacctggccggaagcagct
ggaaaagactcagaaatcttcacagtgaatgggattctgggagagtcagtcactttccct
gtaaatatccaagaaccacggcaagttaaaatcattgcttggacttctaaaacatctgtt
gcttatgtaacaccaggagactcagaaacagcacccgtagttactgtgacccacagaaat
tattatgaacggatacatgccttaggtccgaactacaatctggtcattagcgatctgagg
atggaagacgcaggagactacaaagcagacataaatacacaggctgatccctacaccacc
accaagcgctacaacctgcaaatctatcgtcggcttgggaaaccaaaaattacacagagt
ttaatggcatctgtgaacagcacctgtaatgtcacactgacatgctctgtagagaaagaa
gaaaagaatgtgacatacaattggagtcccctgggagaagagggtaatgtccttcaaatc
ttccagactcctgaggaccaagagctgacttacacgtgtacagcccagaaccctgtcagc
aacaattctgactccatctctgcccggcagctctgtgcagacatcgcaatgggcttccgt
actcaccacaccgggttgctgagcgtgctggctatgttctttctgcttgttctcattctg
tcttcagtgtttttgttccgtttgttcaagagaagacaaggtaggattttcccagaaggt
tcctgcttgaacaccttcactaagaacccttatgctgcctcaaagaaaaccatatacaca
tatatcatggcttcaaggaacacccagccagcagagtccagaatctatgatgaaatcctg
cagtccaaggtgcttccctccaaggaagagccagtgaacacagtttattccgaagtgcag
tttgctgataagatggggaaagccagcacacaggacagtaaacctcctgggacttcaagc
tatgaaattgtgatctag

DBGET integrated database retrieval system