KEGG   Homo sapiens (human): 8832Help
Entry
8832              CDS       T01001                                 

Gene name
CD84, LY9B, SLAMF5, hCD84, mCD84
Definition
(RefSeq) CD84 molecule
  KO
K06511  
CD84 antigen
Organism
hsa  Homo sapiens (human)
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD84; CD84 antigen [KO:K06511]
     8832 (CD84)
Cellular antigens [BR:hsa04090]
 Proteins
  8832 (CD84)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q24
AA seq 345 aa AA seqDB search
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSV
AYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTT
TKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQI
FQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLIL
SSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEIL
QSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaccacctatggatcttgctcctttgcctgcaaacctggccggaagcagct
ggaaaagactcagaaatcttcacagtgaatgggattctgggagagtcagtcactttccct
gtaaatatccaagaaccacggcaagttaaaatcattgcttggacttctaaaacatctgtt
gcttatgtaacaccaggagactcagaaacagcacccgtagttactgtgacccacagaaat
tattatgaacggatacatgccttaggtccgaactacaatctggtcattagcgatctgagg
atggaagacgcaggagactacaaagcagacataaatacacaggctgatccctacaccacc
accaagcgctacaacctgcaaatctatcgtcggcttgggaaaccaaaaattacacagagt
ttaatggcatctgtgaacagcacctgtaatgtcacactgacatgctctgtagagaaagaa
gaaaagaatgtgacatacaattggagtcccctgggagaagagggtaatgtccttcaaatc
ttccagactcctgaggaccaagagctgacttacacgtgtacagcccagaaccctgtcagc
aacaattctgactccatctctgcccggcagctctgtgcagacatcgcaatgggcttccgt
actcaccacaccgggttgctgagcgtgctggctatgttctttctgcttgttctcattctg
tcttcagtgtttttgttccgtttgttcaagagaagacaaggtaggattttcccagaaggt
tcctgcttgaacaccttcactaagaacccttatgctgcctcaaagaaaaccatatacaca
tatatcatggcttcaaggaacacccagccagcagagtccagaatctatgatgaaatcctg
cagtccaaggtgcttccctccaaggaagagccagtgaacacagtttattccgaagtgcag
tttgctgataagatggggaaagccagcacacaggacagtaaacctcctgggacttcaagc
tatgaaattgtgatctag

DBGET integrated database retrieval system